KEGG   Paraburkholderia phenoliruptrix: BUPH_03337Help
Entry
BUPH_03337        CDS       T02300                                 

Definition
(GenBank) stearoyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx01040  Biosynthesis of unsaturated fatty acids
bpx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BUPH_03337
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BUPH_03337
Lipid biosynthesis proteins [BR:bpx01004]
 Desaturase
  First
   BUPH_03337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 SWIRM RdgC ZYG-11_interact NapE
Motif
Other DBs
NCBI-ProteinID: AFT86909
UniProt: K0DUH2
Position
1:complement(3319764..3320960)
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLAHGLLHFSWWQLVLYTLAVTHVTIIGVTVYLHRCQAHRALELHPIVSHFFR
FWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRVEAKNEETM
RKFSHGTPNDWMERNVYTKYPILGVSLMMVLNIALFGVVGLTIWAVQMVWIPFWAAGVVN
GLAHFWGYRNFNSSDASTNIFPWGIIIGGEELHNNHHTYATSAKLSNKWYEFDIGWMYIR
IMSAFRLAKVKKVAPTPRLTTGKLVLDQDTLQAVLANRYEVMARYGKALKRAYRQELAHL
KEVGAREKYQVMRGARSWFHKEEAGLDEPQKRLLPQIFANSQKLKTYIDMRNELAAMWER
SNASRDQLLVQLQDWCHRAEASGIKALQEFAMRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattctttgctcgatttccttgcccacggcctgctgcacttctcgtggtggcaa
cttgtgctgtacacgctcgcggtgacacacgtcacgattatcggcgtgacggtttatctg
caccgctgccaggcgcaccgcgcgctggagctgcaccccattgtcagtcattttttccgg
ttctggctgtggatgaccacgggcatgctgaccggccaatgggcggccattcaccgtaag
caccatgccaagtgcgaaacggaagaagatccgcacagcccgcaaacgcgcggcatctgg
aaggtgctgctcgaaggcgcggagctgtatcgcgtcgaagcgaaaaacgaagagaccatg
cgcaaattcagtcacggcacgccgaacgactggatggagcgcaacgtctacacgaagtac
ccgatcctcggcgtcagcctgatgatggtgctgaacatcgcgctcttcggtgtggtcggt
ctgaccatctgggcggtgcaaatggtctggatcccgttctgggcggccggcgtggtcaac
ggtcttgcgcacttctggggctaccgcaacttcaattcgtcggacgccagcacgaacatc
ttcccgtggggcatcatcatcggcggtgaggaactgcacaacaaccatcatacgtatgcg
acgtcggccaagctgtcgaacaagtggtacgagttcgacatcggctggatgtatatccgc
atcatgtcggctttccgtctcgcgaaggtgaagaaggtcgcgcccacgccgcgtctgacc
accggcaagctggtgctcgaccaggacacgctgcaggctgtgctggccaaccgctatgaa
gtcatggcgcgttacggcaaggcgctcaagcgcgcgtaccgacaggagcttgcgcatctg
aaggaagtcggcgcacgcgagaagtaccaggtcatgcgcggcgcgcgcagctggttccat
aaggaagaagcggggctcgatgagccgcagaagcgtctgctgccgcaaatcttcgcgaac
agccagaagctgaagacctacatcgacatgcgcaacgaactggcggccatgtgggagcgc
tcgaacgcatcgcgcgatcagctgctggtgcagttgcaggactggtgtcatcgtgcagag
gcgagcggcatcaaggcgctgcaggaattcgcgatgcgactgcgccgttatgcttga

DBGET integrated database retrieval system