KEGG   Paraburkholderia phenoliruptrix: BUPH_03831Help
Entry
BUPH_03831        CDS       T02300                                 

Definition
(GenBank) proline dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00250  Alanine, aspartate and glutamate metabolism
bpx00330  Arginine and proline metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BUPH_03831
   00330 Arginine and proline metabolism
    BUPH_03831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpx03000]
    BUPH_03831
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BUPH_03831
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BUPH_03831
Transcription factors [BR:bpx03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BUPH_03831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AFT87562
UniProt: K0DS69
Position
1:complement(4049863..4053792)
Genome map
AA seq 1309 aa AA seqDB search
MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLEKIEQGQLPPELSGAVGSA
DMADGAAVEHDEDGAAHPFLDFAQNVQPQSVLRAAITAAYRRPEPECVPFLLEQARLPAK
LAGDVEALAGKLVETLRGKSRGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWKSHVGQAPSLFVNAATWGLMITGKLVTTNSETSLSSALTRLIGKGGEPL
IRKGVDMAMRLMGEQFVTGENISEALANSRKYEARGFRYSYDMLGEAATTEADAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHPRYSRSQQERTMSELLPRVRSLAVLARRY
DIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIEYIVDLARR
SRHRIMVRLVKGAYWDTEIKRAQVDGLEGYPVYTRKVYTDVSYLACAKKLLGAPDAVYPQ
FATHNAHTLSAIYHLAGNNYYPGQYEFQCLHGMGEPLYEEVTGRDKMNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADENVAIKDLIADPVDEASKIVPLGAPHAKIPLPRN
LYGAERLNSMGLDLSNEHRLASLSSALLASANHPWRAAPMLADDQIALGNARDVRNPADH
RDLVGTVVEASAEHVSAALAHAVATAPIWQATPVEARADCLARAADLLEAQMHTLMGLVV
REAGKSLANAVSEIREAIDFLRYYSAQIRSEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRILREAGVPAGAVQLLPGDGETVGAALVADPRTR
AVMFTGSTEVARLINKTLSSRLDPEGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSS
FDSAGQRCSALRVLCLQDDVADRTLEMLTGAMRELSVGNPDRLSTDVGPVIDVEAKRGID
AHIAAMREKGRRVEQLPLPESCAQGTFVPPTLIELDSIDELKREVFGPVLHVVRYRRSQL
DTLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPAGLPKSLAAALVADLPQAAEKGDNPSAALTALRDWLIAER
EPHLAARCDGYLSHMPAGATAVLSGPTGERNTYTLGARGTVLCIASTASGARMQLAAALA
TGNRALFEGAAGEQLVAQLPASLKPYASVRKNADTPFDAVLFEGDSDELLTLVKEVAKRP
GPIVSVQGAASRALENGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggctagcaccacccttggcgtcaaggtcgacgacctcctgcgttcacggctgaaagat
gccgctacccgcctcgaacgcactccgcactggctcatcaagcaggcgattttcgcgtac
ctcgaaaagatcgagcagggccaattgccgccggagttgtccggcgcggtgggctcagcc
gatatggcagacggcgcagcggtcgaacacgacgaggacggcgcagcgcatccgtttctc
gattttgcgcagaacgtgcaaccgcaatcggtgttgcgcgcggcgatcacggcggcctac
cggcggccggagccggaatgcgtgccgttcctgctcgagcaggcgcgactgccggcgaag
ctcgcgggcgacgtcgaggcgctcgccggcaagctcgtcgagacgctgcgcggcaagagc
cgcggcggcggcgtggaaggtctgatccacgaattctcgctgtcgagccaggaaggcgtc
gcgctgatgtgtctcgccgaagcgctgctgcgcattcccgaccgcgccacccgtgacgcg
ctgatccgcgacaagatcagcaagggcgactggaaatcgcacgtcggccaggcgccttcg
ctgttcgtcaatgcggcgacctggggcttgatgatcaccggcaagctggtcacgaccaat
agcgagacgagcctgtcgtcggcgcttacgcgtctgatcggcaagggcggcgagccgctc
atccgcaaaggcgtggacatggcgatgcgcctgatgggcgagcagttcgtcacgggcgag
aacatctccgaagcgctcgcgaacagccgcaagtatgaagcgcgcggcttccgctactcg
tacgacatgctcggcgaagcggccaccaccgaggccgacgcgcagcgctactacgcgtcg
tacgaacaggccattcacgcgatcggcaaggcggccggcggccgcggcatctacgaaggc
ccgggcatctcgatcaagctgtcggcgctgcatccgcgttactcgcgctcgcagcaggaa
cgcacgatgagcgagctgctgccgcgtgtgcgttcgcttgcggtcctcgcgcgccgctac
gacatcggcctgaatatcgacgctgaagaagccgaccgcctcgaactgtcgctcgatctg
ctcgaagcactgtgcttcgacccggaactggccggctggaacggcatcggcttcgtggtg
caggcttatcagaagcgctgcccgttcgtgatcgaatacattgtcgacctcgcgcgccgc
agccgtcaccgcatcatggtgcgcctcgtgaagggcgcgtactgggacaccgaaatcaag
cgcgcgcaagtggacggcctggaaggctacccggtctacacgcgcaaggtctacaccgac
gtgtcgtacctcgcctgcgcgaagaagctgctcggcgcgcccgacgcggtgtatccgcag
ttcgccacgcacaacgcgcacacgctctcggcgatctatcacctcgcgggcaacaactac
tatccgggccagtacgagtttcagtgcctgcacggcatgggcgaaccgctgtacgaagag
gtgacgggccgcgacaagatgaaccgtccgtgccgcgtgtatgcgcccgtcggcacgcat
gaaacgctgctcgcgtacctcgtgcggcgtctgctggaaaacggcgcgaacacgtcgttc
gtgaatcgcatcgccgatgaaaacgtcgcgatcaaggacctgatcgccgatccagtcgac
gaggcgtcgaagatcgtgccgctcggcgcgccgcacgccaagattccgttgccgcgcaat
ctgtatggcgccgagcgcctcaattcgatgggcctcgatctgtcgaacgagcatcgtctc
gcgtcgctgtcgtcggcgttgctcgcgagcgcgaaccatccgtggcgcgccgcgcccatg
ctcgccgacgatcagatcgcgctcggcaacgcgcgcgacgtgcgcaacccggcggatcat
cgcgacctcgtcggcacggtggtggaagcgagcgcggaacatgtgagcgccgctctcgcg
cacgctgtggccaccgcgcccatctggcaggcgacgccggtcgaagcgcgcgccgattgc
ctcgcgcgcgccgccgatctgctcgaagcgcaaatgcatacgctcatgggtctcgtcgtg
cgcgaagcgggcaagtcgctcgcgaacgcggtgtcggaaatccgcgaagcgatcgacttt
ctgcgctattactccgcgcagatccgcagcgagttttcgaacgacacgcatcgtccgctc
gggccggtcgtgtgtatcagcccgtggaacttcccgctcgcgattttcatgggccaggtg
gccgctgcactcgcagccggcaacacggtgctcgcgaagcccgctgagcaaacgccgttg
atcgccgcgcaagccgtgcgcattctgcgcgaggccggcgtgccggcgggcgccgtgcaa
ctgctgccgggcgacggcgaaacggtcggcgctgcgctggtggccgacccgcgcacgcgt
gctgtgatgttcaccggttcgacggaggtcgcgcgcctgatcaacaagacgctctcgagc
cgtctcgacccggaaggcaagccgattccgctgatcgccgaaaccggcggtcagaacgcg
atgatcgtcgactcgtcggcgctcgcggagcaggtggtggcggacgtgctgcagtcgtcg
ttcgattcggccggtcaacggtgctcggcgttgcgcgtgctgtgcctgcaggacgacgtc
gcggaccgcacgctcgaaatgctgacgggcgcaatgcgtgagctgagcgttggcaatccg
gaccggttgtccaccgatgtcggcccggtgatcgacgtggaagcgaagcgcggcatcgac
gcgcatatcgccgcgatgcgcgaaaaaggccgcagggtcgagcaactgccgctgccggaa
agctgcgcacaaggcacgtttgtgccgccgacgctgatcgaactcgacagcatcgacgaa
ttgaagcgggaagtgttcggcccggtgctgcacgtggtgcgctatcgccgcagccagctc
gacacgctgctcgaacagatccgcgccacgggttacggactgacgctcggcatccatacg
cgaatcgacgaaaccattgcgcacgtgatcagccgcgcgcatgtcggcaacatctatgtg
aaccgcaatgtgatcggcgcggtggtcggcgtgcagccgttcggcggcgaaggcctgtcg
ggcacgggtccgaaggccggcggcgcgctgtatctgcagcgtctgctcgccacgcgtccg
gcgggcttgccgaagtcgcttgcagcggcgctcgtcgccgatctcccgcaagctgcggaa
aagggcgacaatccgtccgccgcgctgacggcgctgcgcgactggctgatcgccgaacgc
gagccgcacctggccgcgcgctgcgacggttatctgtcgcacatgccggcgggcgcgacg
gcggtgctgtccggaccgacgggcgagcgcaacacctacacgctcggcgcacgcggcacg
gtgctctgcattgcgtcgacggcaagcggcgcgcgcatgcagttggcggccgcgctggct
acgggaaatcgtgcgctgttcgaaggcgctgccggtgaacaattggtggcgcagttgccc
gcgtcgctcaagccgtatgcgagcgtgcgcaagaatgccgacacaccgttcgacgccgtg
ctcttcgaaggcgacagcgacgaactgctgacgctcgtgaaggaagtggcgaagcgcccg
ggcccgatcgtgtcggtgcaaggcgccgcgtcgcgcgcgctggagaacggcgacgaagac
tacgcgctcgagcgtctgctgacggaacgctcggtcagcgtgaacacggccgcggccggc
ggcaatgcgaatttgatgacgatcggctga

DBGET integrated database retrieval system