KEGG   Paraburkholderia phenoliruptrix: BUPH_04934Help
Entry
BUPH_04934        CDS       T02300                                 

Gene name
acoC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00010  Glycolysis / Gluconeogenesis
bpx00020  Citrate cycle (TCA cycle)
bpx00620  Pyruvate metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUPH_04934 (acoC)
   00020 Citrate cycle (TCA cycle)
    BUPH_04934 (acoC)
   00620 Pyruvate metabolism
    BUPH_04934 (acoC)
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BUPH_04934 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase PGAP1 Esterase Ser_hydrolase Biotin_lipoyl_2 DUF1057 Abhydrolase_5 PTS_EIIA_1 Abhydrolase_3 LIDHydrolase Ndr DUF2048 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AFT90382
UniProt: K0E0S1
Position
pSYMBR3459:complement(491030..492148)
Genome map
AA seq 372 aa AA seqDB search
MADIIPIVMPKWGLEMSEGTVQDWLVREGERIEVGQALVDVDTDKISNAVEASDPGLLRR
IVAQSGETLPVKALLGVLAETDVSDAEIEAYIAAFEVPAIDSQDEYAGPAFDYVEVDDIR
VRYARRGPNEGRPVLFIHGFGGDLNNWVFNIDAVAEQHPVIALDLPAHGQSQPKLPGTSI
AGLADFVLKFLDTLDVSGPVHLVGHSMGGAIALQMARDAPARVASLALVSPAGFDAAVNT
GYTDGFVKAQSRRDLKPVLEQLFADPGLVSRQMIDDMLKFKRMDGVEPLLAELGAALFKD
GKQSAVLVGDLRTFSKPMLVFWGKDDRVIPADQAANAPPVAQVILFDATGHMAMLEKAGE
VNAALQRHLSAG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcattccgattgtgatgcccaagtgggggctggagatgtccgaaggcacc
gtacaggactggttggtccgggaaggcgagcgcatcgaagtggggcaggcgctggtcgat
gtggataccgacaagatttccaacgcggtggaagcctcggatcccggactgctgcgccgt
atcgtcgcgcagagcggcgagacactgcccgtcaaggcgttgctgggcgtgctcgcagag
acggatgtcagcgacgccgagattgaagcctacatcgccgcgttcgaggtgccggctatc
gacagccaagacgagtacgctggtccagcgttcgactatgtcgaggtcgacgatatccgc
gtgcgttacgcgcggcgcggaccgaacgagggccggcccgtgctgttcatccacggcttc
ggtggcgacctgaacaactgggtgttcaatatcgacgcggtggcggagcaacacccggtg
attgcgttggacctcccggcgcacgggcaaagccagcccaagctgcctggcacgtccatc
gcggggctggccgacttcgtgttgaagttcctggataccttggacgtgagcgggccggtg
catttggtgggtcattcgatgggcggcgccatcgcgctgcagatggcgcgcgacgcgccg
gcacgcgtggccagcctagccctggtcagcccggccggtttcgatgctgccgtcaacact
ggttataccgacggcttcgtcaaggctcagtctcgccgcgacctcaagccggtactggaa
cagctgttcgccgatccggggttggtgagtcgccagatgatcgacgacatgctcaagttc
aaacgcatggatggggtcgagccgttgctggccgaattgggcgccgcgctgttcaaggac
ggcaagcagtcggccgtgctggtcggcgatctgcgtacgttcagcaagcccatgcttgtt
ttctggggcaaggacgaccgcgtgattccggcagaccaggcggccaacgcaccaccagtc
gcacaggtgatcctgttcgacgcaaccggccacatggccatgcttgaaaaggccggcgag
gtgaacgccgcattgcaacggcatttgtccgcgggttga

DBGET integrated database retrieval system