KEGG   Paraburkholderia phenoliruptrix: BUPH_06113
Entry
BUPH_06113        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BUPH_06113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06113
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06113
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C DUF4381
Other DBs
NCBI-ProteinID: AFT89640
UniProt: K0DXI1
Position
2:complement(2348717..2352592)
AA seq 1291 aa
MRRFLNVLTHPRTLSIIGLLALAAVLFVGADTLQIDLMWPAIALAALVALWLLVWVVRRL
RARRANDKLGEMLEQQAEKQSADAGPAPTPARQAELDVLRTRLVDAVKTIKTSKIGQLSG
GSALYELPWYIVIGNPAAGKSSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGIL
LDTAGRYSVHEEDRTEWLGFLGLLKKFRPKAPINGIIVTASIAELTSSKPEFAINLAKNL
RQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRHEYDRVWGATLPYEPDEKRDV
VGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALRAFLATLFETN
PFQYKPIFRGFYFTSALQEGETSSAAATRIANRFGLSAESMPKPHSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRMRYSTFFGFVAVLALALGGWTWSTVNNQQLAENVKADLDN
VVRLQQNRNDLQSRLQAMDVLEDRIDQLEQFRRDKPLAVSLGLYQGDRLEQRLLTEYYNG
VRQILLDPVSQNLASFLKDVNAHPDQLAPLNRTPDAAAIPVSTHSAMTASGQGGLYSDAS
PTNVEDAYNALKTYLMLSDKRHVETAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMI
TFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIA
RIVGENNTALVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLNTSAHDDLTLE
GSPEQIQKALVMMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIG
QEFSALGRIVQTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSE
LADSLKYVDEQMLTGLTDSQRKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQ
NSLASKYPFAGDAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLTARTWGDMG
LALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQILPQPSSGTTEYTLAIDGQQM
RYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLINSAQRKRRPD
GTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAANSVAA
TNTASSAAPVASAVPAARPATAAVSNTGGAQ
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgcgacgctttctcaacgtgttgacccatccacgcacgctctcgatcatcggcctgctc
gcgctcgctgcggtcctcttcgtcggcgccgatacactgcagatcgacctgatgtggccg
gccatcgcgctcgctgcgctcgtcgcgctatggctgctcgtatgggtggtgcgccgcctg
cgcgcgcgtcgcgcgaacgataaactcggcgaaatgctcgagcagcaggcggaaaagcag
agcgccgacgcgggaccggcgcccacgccggcgcgccaggcggaactcgacgtgctgcgc
acgcgcctcgtcgacgcggtcaaaaccatcaagacttcgaagatcggccagctgtcgggc
ggctcggccctgtatgaactgccgtggtacatcgtgatcggcaatcccgccgcgggcaaa
agcagcgccgtgctgaactcgggcttgcaattcccgttcgccgacaaaaacaacgcggtg
atccacggcattggcggcacgcgcaattgcgactggttcttcacgacagagggcattctg
ctcgacacggcaggacgctactccgtgcatgaggaagaccgtaccgaatggctcgggttt
ctcggcctgctcaagaagttcaggcccaaagcgccgatcaacggcatcatcgtgaccgcg
agcattgcggaactcaccagcagcaagcctgaattcgccatcaatcttgcgaagaacctg
cgccagcgcgtgcaggaattgaccgaaaagctggaggtgttcgcgccggtctacgtgatg
ttcaccaaggccgacctgatcacaggcttcaccgaattcttcagcggcagcgaccgtcac
gaatacgaccgcgtgtggggtgccaccctgccctacgagccggacgaaaagcgcgacgtg
gtcggccttttcgacgaacacttcgaagaactctatgacggcctgaaagaaatcagcgtc
gcgcagatgtcgatcaaccgcggcaacaagctctcgccgggccaactgagcttcccgctc
gaattctccacgatcaagcccgcgcttcgcgcctttctcgccacgctgtttgaaacgaac
ccgttccagtacaagccgatcttccgcggcttctatttcacgagcgccttgcaggaaggc
gaaaccagcagcgccgcggccacgcgcatcgcgaaccgcttcggcctgagcgccgaaagc
atgccgaagccgcacagcgcgttctcaaagaacgggttcttcctgcgcgacctcttttcc
aaggtcattttcgcggaccggcaaacggtcaggcaattcgccagccccgcgaagacgcgc
atgcgctattcaacgtttttcggcttcgtcgccgtgctcgcgctggcgctcggcggctgg
acatggtcgaccgtcaacaatcagcaactcgcggagaacgtcaaggccgatctcgacaac
gtcgtgcgtttgcagcagaaccgcaacgacctgcaatcgcgactgcaggcaatggacgtg
ctcgaagaccgtatcgatcagctcgaacagttccgccgcgacaagccgctcgctgtttcg
ctcggcctgtatcagggcgatcgtctcgaacagcgtcttctgaccgagtactacaacggc
gtgcgtcagattctgctggatccggtttcgcagaacctcgcgtcgttcctgaaggacgtc
aacgcgcatccggatcagctcgcgccgctcaatcgcacaccggacgccgccgcgattccc
gtctcgacgcatagcgccatgacggcgagcggccagggtggcctttacagcgacgcgtcg
cctaccaatgtggaagacgcatacaacgcgctcaagacgtacctgatgctcagcgacaag
cgtcacgtggaaacggctcacctgaccgaccaggtggcgcgtttctggcgcggctggctc
gaaacgaatcgcggcaacatgcctcgcgacgaaatgatccgcagcgccgagcgcatgatc
accttctacctgtcccgcgtgtccgacgacgactggccgatgatcgaccagaacctcggc
ctcgtcgatcagactcgcgagaacctgcgtcgcgtggtgcgcggcatgccggcgcgtcag
cgcgtctatgaggagatcaaggcgcgcgcctccacccgctttgcgccgatgaccatcgcg
cgcatcgtcggtgagaacaatacggcgctcgtggcgggcagctacgcgattcccggcaca
tttacgcgggaagcgtggttccagtatgtgcagcccgcgattcgcgaggcggcgacgaag
gaattgcaggcgaaagactgggtgctcaacacctccgcgcatgacgacctgacgctcgaa
ggcagccccgagcagatccagaaagcactggtcatgatgtacaagaccgagtatgcaatg
cactggcagaagttcatgcaaggcatcgcggtgcagagcttcggcagcttcgggcaggct
gtggacgcgatgaaccgcctcggcgacccgcaggattcgccgatccgcaaagtactcgaa
acggcgtatgaccagacttcgtgggacaacccgtcgctcttcaacgcgagcctgaaacgc
gcgcaaagcggcgtgacgagctggttcaagcaatggttctcgcgcgcgccgaccggccag
ctgaacgcgaacatcgacatcaacggcaatccggtggaaatgccgatgggtcccatcgga
caggaattttccgcgctggggcgtattgtccagacgggcgacaacggctcgatgctcaag
ggctatatggacacgttgtccaaggtccgcacgcgctttaacgtcatcaagaaccagggc
gatccgggaccgggcgcgcgtcagctcatgcagcagacgctcgacgggagcggctccgaa
ctcgcggattcgctcaagtatgtcgacgagcagatgttgacgggcctcaccgattcgcag
cgtaaagccctgcgtccgctgctcgtacgccctttgatggccgcgtacgccgtggtgatc
cagcctgccagcgtcgaagtcaacaaggtttggaatgcacaggtgtaccaaacattccag
aactcgctcgccagcaaatatccgtttgccggcgacgcgaaggtggaagccggtgctggt
gaaatcgcacaggtgttcggaccggacggctcgattgcgaagttcgtcgggaccacgctc
gggccgctcgcggtgcgccgcggcgacacgctgacagcgcgcacatggggcgacatgggc
ctcgcgctcacgccggacttcacgaatgggttcgcgcgctgggtcgcgccgcttgcgggc
ggtgcagcgggcgcctcggcaggccagagctcggcggaaccgcagaccgtgttccagatc
ctgccgcagccgagcagcggcacgaccgagtacacgctcgccatcgacggccagcagatg
cgttaccgcaacacgccgccgcaatggaccaacttcgtgtggccgaatccgtcggggtcg
cccggcgccacgctatcggccacgaccttcgacggacgcaccttgcaactcgtcaacgaa
ccgggccgctacggtctcgagaagctgatcaattcggcgcagcgcaagcgtcgcccggac
ggcaccttcgatctgtcgtggacgcaaggcaacgtgacggtggcggtcagcatgcgcatc
atcagcacgtcgcaagcctcgggcggcagcagcgacgcgccgcagcagcaaagcctgcgt
gggctgcgtctgccttcttcggtggcggacgtaagcgcggcggccaattccgtcgctgcc
acgaacacagccagtagtgcggcgcccgtcgcgtcggcggtgccggcggcgcggccggcc
acggccgcggtttcgaacacaggaggtgcgcaatga

DBGET integrated database retrieval system