KEGG   Paraburkholderia phenoliruptrix: BUPH_06115
Entry
BUPH_06115        CDS       T02300                                 

Gene name
ompA
Definition
(GenBank) Outer membrane protein A
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpx02000]
    BUPH_06115 (ompA)
Transporters [BR:bpx02000]
 Other transporters
  Pores ion channels [TC:1]
   BUPH_06115 (ompA)
SSDB
Motif
Pfam: OmpA BON Pilus_CpaD FinO_N HtaA
Other DBs
NCBI-ProteinID: AFT89638
UniProt: K0DZU8
Position
2:complement(2346758..2347660)
AA seq 300 aa
MGLVTPLAHADNDGPARVTPVDNSSMSIRTTALPSASSGAPALNTAGLASGTTGAGTGAV
TASPPPANATPGQVVVGGKVPDEATKAAVLARLRDTYGAANVVDQIEVADVATPPNWSAN
VQKLIGPQLKQISKGQLKIDGTQIDVKGEVRNESQRQQLASDMANALNPTYTIKNGLRVS
ASEQGLLDQTLANRTIEFETGSATLTPQGRAILDQMAAAMQKMTTKTVAIIGHTDNSGNR
ASNIALSQARADAVKGYLVAKGIPPQQMSTTGVGPDQPIASNDTADGRARNRRIEFRAGS
NT seq 903 nt   +upstreamnt  +downstreamnt
gtgggcctggtcaccccgctcgctcacgccgacaacgatggcccggctcgcgtcacgccg
gtcgacaacagcagcatgtcgattcgcacgacggcgctgccctccgcttcgtccggtgcg
cctgcgctcaacaccgcgggcctcgcgagcggcacgaccggcgccggcaccggcgcggtg
acggcgtcgccgccgcccgccaacgcgacgccgggccaggtcgtggtcggcggcaaggtg
cccgacgaagccaccaaagccgctgtgctcgcgcgtttgcgcgacacgtatggcgcggct
aacgtcgtcgatcagatcgaggtcgccgacgtcgcgacgccgccgaactggtccgcgaat
gtgcaaaagctgatcggcccgcaactcaagcagatcagcaaggggcagttgaaaatagac
ggcacgcagatcgacgtgaagggcgaagtgcgcaacgagtcgcaacgtcagcaactcgcg
agcgacatggcgaatgcgctgaatcccacttatacgatcaagaacggcttgcgcgtgagt
gcctccgagcagggcctgctcgaccagacgctcgccaatcgcacgattgaattcgaaacc
ggcagcgcgacgctcacgccgcaaggccgcgcgattctcgaccagatggcggcggccatg
cagaagatgacgacaaagaccgtcgcgatcatcggtcacacggacaactcgggcaaccgc
gcgtcgaatatcgcgctgagccaggcacgcgccgatgccgtgaagggttacctcgtcgcc
aagggcattccaccgcagcagatgagcacgacgggcgtcggccccgaccagccgatcgcg
tcgaacgatacggcggacggacgcgcgcgcaaccggcgtatcgagtttcgcgcggggtcc
taa

DBGET integrated database retrieval system