KEGG   Paraburkholderia phenoliruptrix: BUPH_06116
Entry
BUPH_06116        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06116
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06116
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AFT89637
UniProt: K0DYA3
Position
2:2345541..2346659
AA seq 372 aa
MPINLNTLLAPITEAAPCGEDLLFSADFDAIQHARRFEDPSLDQGEWVTDIKEADWPFVV
ERSSALLQTQTKDLRLAVWLTEALAIEEGITGLTQGYALLTGLCEKYWDAVHPLPEGDDT
EYRLGNVAWLVGRTGDLLRAMPLTSSQGNVYSTIDWDVAAHVAQAVKRDPDHADDIARGK
PSIEQIDASKRATPPAFYSTLLAELKAFEAAMLALEQELDRRAADSAPSFRQARDAYESV
FRLAERFARELGVNIQAQQAPASGASAATSHEHERAEPTFKTSLQREEPVLTPTPTTAIA
GIQSRAHAVAQLRAVARFFRSTEPHNPAAYFADKAAEAADMPLHQWLSTVVKDDGSLAHI
RELLGVKPEENS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgccgatcaacctgaacacgctgcttgctcccattacagaggctgcgccctgcggcgaa
gatctgctcttttccgccgatttcgatgcgatccagcacgcgcggcgttttgaagacccg
tcgctggatcaaggcgaatgggtcaccgacatcaaggaagccgactggcctttcgtggtg
gagcgctccagtgcgttgctgcagacgcagaccaaagacttgcgcctcgcggtctggctc
acggaagcactcgccatcgaggagggcataaccggcctcacacagggatacgcgctgctg
accgggttgtgcgaaaagtattgggatgcagtccatccgctgccggagggcgacgatacc
gagtaccgcctcggcaatgtggcgtggctcgtgggacgaaccggcgatctgctgcgtgcg
atgccgctgacgtcgtcgcaaggaaacgtgtacagcacaattgactgggacgtcgccgcg
cacgttgcgcaagccgtgaagcgcgatcccgatcatgccgacgacatcgctcgcggcaag
ccttccattgagcagatcgacgcgtcaaagcgtgccacgccccccgcgttttactcgacg
ttgctggccgagctgaaggctttcgaagcggcgatgctcgcgctggagcaggagttggac
cgccgcgctgccgactccgcgccgagcttccgtcaagccagggacgcgtatgaaagcgtg
ttccgtcttgccgaacgctttgcgcgcgagctgggcgtgaatatccaggcgcagcaggcg
cccgccagtggcgcgagcgcggcgacgtcccatgaacacgaacgtgcggagcccacgttc
aaaacctcactgcaacgcgaggagcctgtgttgacccctacgccgaccaccgccattgca
ggaatccagagccgcgcgcacgcggtcgcccagttgcgtgccgtggcgcggttctttcgc
agcacggagccccacaatccggctgcatacttcgccgacaaagctgcggaggccgccgac
atgccgctgcaccagtggctctccacggtggtgaaagacgacgggtcgctcgcgcatata
cgcgagctgctgggtgtgaagcccgaagaaaacagttag

DBGET integrated database retrieval system