KEGG   Paraburkholderia phenoliruptrix: BUPH_06120
Entry
BUPH_06120        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpF
  KO
K11897  type VI secretion system protein ImpF
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06120
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06120
SSDB
Motif
Pfam: GPW_gp25 CSTF_C
Other DBs
NCBI-ProteinID: AFT89633
UniProt: K0DZU1
Position
2:2339310..2339789
AA seq 159 aa
MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKSTVARDVEAILNTRIALTEHELAALP
ECQRSVLTYGLNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVSVTLELNEQSTNAL
YFAIQALLVVHPAEEPVSFDAMLQPSTLQYSVTRARAKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaaacgcttcgaacccagctttctcgacaagctgttcgacgacgaaccgcatttgccg
gcttccccggcgatgcggcaattgtcgttggacgaattgaaaagcacggtcgcgcgcgac
gtcgaggcaatattgaatacgcgcattgcgctgaccgagcacgagctggccgctttgccc
gagtgtcagcgctccgtgcttacttatggtctgaacgacttcgcaggtctgagtctcgcg
agtcactatgaccgcacgttcatctgtaaatcgattcagcaggccattgcacggcatgag
ccgcgcttgcagcaggtatcggtcacactcgaactgaacgaacaatcgaccaatgcgctt
tacttcgccattcaggcgctgctggtcgttcatccggcagaagaaccggtgagtttcgac
gcaatgttgcagccttccacattgcaatactcggtgacgcgcgcacgcgcgaaactgtaa

DBGET integrated database retrieval system