KEGG   Paraburkholderia phenoliruptrix: BUPH_06121
Entry
BUPH_06121        CDS       T02300                                 

Definition
(GenBank) type VI secretion system secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BUPH_06121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06121
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06121
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFT89632
UniProt: K0DY93
Position
2:2338723..2339226
AA seq 167 aa
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHAITQPRSATASTAGGHTSERCEHADMV
FTKDIDVVSPLIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVG
EGLPSEQFSLKYAAVQWKYTQQKIGGNQGGNAQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaggacatctatttaaaattcggcaatccggcgatcaaaggcgagtccgccgataag
gatcacgctggctggatcgaaatcgattcgtggagccacgcaatcacgcaaccgcgttcg
gcgacggcatccaccgcaggcggccacacgtccgagcgttgcgaacacgccgacatggtg
ttcacgaaagacatcgacgtggtgagcccgctgatttatcagcacgcctcgggcggcacg
acgttcgacgaagtcacgatcgacttcatgcgttcggacggtgaaggcaatcgcatcaag
tacctcgaagtgaagctcaaatacgtgatcatctcgagcgtcacgccgagcgtcgtgggc
gaaggtttgccgagcgagcaattctcgctgaagtacgctgccgtgcagtggaagtacacg
cagcagaagatcggcggcaatcagggcggcaatgcgcagggcgcgtggagcctgacgaag
aacgacaagacctacgcggtgtaa

DBGET integrated database retrieval system