KEGG   Paraburkholderia phenoliruptrix: BUPH_06122
Entry
BUPH_06122        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06122
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06122
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFT89631
UniProt: K0DTR4
Position
2:2337159..2338649
AA seq 496 aa
MNQQTAAAQLATAQSGAESTLLDEIVEKSRVAKSDSEHARAKDLIGELVREVLDGTVVVS
DNLSATIDARVAELDRLISAQLSAVMHAPEFQRMESTWRGLDYLCKESNTGATVKIKALH
APKRDLVRDFKTAIEFDQSALFKKIYEEEFGTFGGSPFGAIIGDFEVTRQPEDVYFIEQM
SHVAAAAHAPFIASASPELLGLETFADLGKPRDLGKVFDTVEYAKWKSFRDSEDSRYVGL
TLPRFLGRLPFNPKDGATAEGFNFVEDVDGTDHSKYLWCNAAWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
EVFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGAYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaatcagcaaacggcagcagctcaactcgccactgcgcaaagcggcgctgaatccacg
ctgctcgatgagatcgtcgagaaaagccgcgtggcgaagtcggattccgaacacgcgcgc
gcgaaagatctgatcggcgaactcgtgcgcgaggtgctcgacggcacggtggtcgtctcc
gacaatctgtcggccaccatcgacgcgcgcgttgccgaactcgaccgcctcatttcggcg
cagttgagcgcggtgatgcacgcgcccgagtttcagcgcatggaaagcacgtggcgcggg
ctcgattatctgtgcaaggagagcaacaccggcgccacggtcaagatcaaggcgctgcat
gcacccaagcgcgatctggtgcgcgacttcaagaccgcgattgaattcgaccagagcgcg
ctcttcaagaagatctacgaagaagagttcggcacgttcggcggctcgccgttcggcgcg
atcatcggcgacttcgaggtcacgcgccagcccgaagacgtgtactttatcgaacagatg
tcgcacgtcgcagcggccgcgcatgcgccgtttatcgcgtcggcgtcgcccgaattgctg
ggccttgaaacgtttgccgatctcggcaagccgcgcgacctcggcaaagtattcgatacg
gttgaatacgccaagtggaagtcgtttcgcgactcggaagactcgcgctacgtcggcctc
acgttgccgcgttttctcggccgcctgccgttcaatccgaaagacggcgccacggcggaa
ggcttcaacttcgtcgaggacgtggacggcacagaccacagcaagtacctgtggtgtaac
gcggcatgggcgttcgccgcgcgtctcacggccgcattcgacgacttcggctggtgcgcc
gcgattcgcggcgtggaaggcggcggtctggtcgaagatctgcccacccacacgttcaag
accgacgacggcgaaatcgcgctgaaatgcccgaccgaaatcgcgattacggaccgccgc
gaaaaagaattgagcgacctcggcttcattccgctcgtgcattgcaagaactccgactac
gccgcattcttcgccgcgcaatcggtgcaaaagcccaagaaatacagcaccgacagcgcc
aatgccaacgcggttctgtccgcgcaattgcagtacatcttctccgtatcacgcgttgcg
cattacctgaaggcgatgatgcgcgacaagatcggcagcttcgcgtcggcgcaaaacgtg
gaagtgttcctgaatcgctggatctcgcagtacgtgctgctggacgacaacgccacacag
gaacagaaagcgcagtttccgctgcgcgaagcatcgattcaggtgtcggagattcctggt
aagcccggcgcctatcgttccgtcgcgtttttgcgcccgcatttccagctcgacgaactg
tccatttcgttgcggctcgtcgccgatctgccgaaaccggccaattcataa

DBGET integrated database retrieval system