KEGG   Paraburkholderia phenoliruptrix: BUPH_06123
Entry
BUPH_06123        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06123
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06123
SSDB
Motif
Pfam: T6SS_VipA DUF6221
Other DBs
NCBI-ProteinID: AFT89630
UniProt: K0DXH3
Position
2:2336617..2337144
AA seq 175 aa
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVDNRLSEAGGKFAVDLRFKSMADFNPDEVVAQIEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLNNTQQLQTLAKDHGGAPDHDKQGE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcgaagaaagaaagcatacaaaaacgcttgcagaaagtgcggccgccccgcgtgcag
ctcacctatgaggtggagcgcggcgatgcgatcgaagtgaaggagctgccgttcgtcgtc
ggcgtggttgccgatctggcggggcagtcggaagtcgaacagccgaagctgcgcgatcgc
aagttcgtcaacatcgaccgcgacaatttcgacgacgtcatgaaggcgatcgagccgcgc
gctgcttttcaggtggacaaccgtctaagcgaagccggcggcaaattcgcagtcgatctg
cgtttcaagtcgatggccgatttcaatccggacgaagtggtcgcgcaaatcgagccgctg
cggcgtctgctcgaagcgcgctcgaagcttgccgacctgcgcaacaagctggccggcaac
gacaagctggaagacctgctctccgaagtgctcaacaacacgcagcagctgcagacgctg
gcgaaagaccacggcggcgcgccggatcacgacaagcaaggcgaataa

DBGET integrated database retrieval system