KEGG   Paraburkholderia phenoliruptrix: BUPH_06126
Entry
BUPH_06126        CDS       T02300                                 

Definition
(GenBank) type VI secretion system protein ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06126
Secretion system [BR:bpx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BUPH_06126
SSDB
Motif
Pfam: T6SS_VasE DUF5655
Other DBs
NCBI-ProteinID: AFT89627
UniProt: K0DY85
Position
2:complement(2333430..2334776)
AA seq 448 aa
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRDALGSNVL
RVSELSLVFPDGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYSQDSN
AGFVARYVSEETPVADHFTDAAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSG
FEIDDSFVPPCLAIEASPVLHQRLRQLIDALQAKVNALYGFHREPTKNIIEFRSGDIASF
WLLHTASAAFASLAHLYQHSALHPERLFQELLRLAGQLMTFSKGYALSDLPAYRHDDPGP
GFARLDTILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKIDDKTLFYIAVSADMPTA
ELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPVRPGACYFSCEPRGGLYE
RMLQAQSAMIYAPSGINDLQLELIAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagttattccgcaaaagtgctctggggagaaggcctgtttctgcggccgcagcatttt
cagcgtcaggacgcctaccatgaggcgcgcctcttcgagtcgattcaggccatccagccg
tacaactggggcgtgcgctctgcgcgcttcgaccgcgacgcgctcggcagcaacgtgctg
cgcgtgagcgaactgtcgctggtgtttcccgacggcgcgctctactccgcgccgcaggcg
gacgacctgccgccgcccatcgcgctcgacacgctgccggacggcatcaacgaattcacg
ttttatcttgcgctgcatccgctgcgcgagacaggcgccaactattcgcaggacagcaac
gcgggcttcgtcgcgcgttacgtgagcgaagagacgccggtagcagaccatttcacggac
gccgccgaagccgacatcacctttctcaagacgagcgtcaagctgatcgcgcacagcgag
ccgcgcgatcaactgctctcggtgccgctcgtgcgcgtgcgccgcacggccacctcaggc
tttgaaatcgacgacagcttcgtgccgccctgtctcgcgatcgaggcatcgccggtgctg
catcagcggctgcgccagttgatcgacgcattgcaggcgaaagtcaacgcgctgtacggc
tttcaccgcgagccgaccaagaacattatcgagttccgttccggcgacatcgcgtcgttc
tggctgctgcacacggcaagcgcggcgttcgcgtcgcttgcgcatctgtatcagcattcg
gcgctgcatccggagcgcctctttcaggaattgttgcgccttgccggccaactgatgacg
ttctcgaagggctatgcgctctccgatctgccggcttatcgccacgacgatccggggccc
ggcttcgcgcgcctcgacacgatcctgcgcgatctgctcgaaacggtgatctccacgcgg
tactttgccatcgcgctggaagaagtgcgcccgtcgtttcatgcgggccggctcgattcg
ggcaagatcgacgacaagaccctgttttacattgccgtgtccgcggacatgcccactgcc
gagctcgtggaagcggtgcccgcgcgcttcaaggtgggtgcgcccgacgatgtcgacaag
ctcgtgctctcggccatgccgggcgtgcggctcgtgtacacgccgcaggtgccgcccgcg
attccggtgcggcctggcgcctgctatttctcctgcgagccgcgcggcgggctgtacgag
cgcatgctgcaagcgcagtccgccatgatctacgcgccctcgggcatcaacgatcttcaa
cttgaactgatcgcggtcacctcatga

DBGET integrated database retrieval system