KEGG   Paraburkholderia phenoliruptrix: BUPH_06128Help
Entry
BUPH_06128        CDS       T02300                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00030  Pentose phosphate pathway
bpx00480  Glutathione metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
Module
bpx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bpx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bpx_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BUPH_06128
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BUPH_06128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpx04147]
    BUPH_06128
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BUPH_06128
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BUPH_06128
Exosome [BR:bpx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BUPH_06128
  Exosomal proteins of colorectal cancer cells
   BUPH_06128
  Exosomal proteins of bladder cancer cells
   BUPH_06128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFT89625
UniProt: K0DXG8
Position
2:2331084..2332565
Genome map
AA seq 493 aa AA seqDB search
MTTQHASATPELPLDMIIFGGTGDLSFRKLLPALYMAHLHCNLPPETRILTIGRKPWSRE
EYIAEFMEQKAKPFIEKKAFDAAAWDKFLALFEYVRMDVDSAEDYQRLKEASRDGVRRAF
YLATSPDLFTNICDNLSAAGLVDELSRVVLEKPLGHDLASAKEINTAVGKHFSEAQIYRI
DHYLGKETVQNLMVLRFGNPIFGPLWQAPYIKRVQITVAETVGVGSRAGFYDKTGALRDM
VQNHLLQLLCIVAMEPPVSLDPDAVRDEKLKVLRSLRPMTPEDIARDTVRGQYTAGAVDG
EAVKGYLEEENVPAGSRAETFVALRAHINNWRWANVPFFLRTGKRMQKKVSEIVIEFSDL
PFSIIPSGGRNYGNRLVIQLQPEESIQLQMLAKEPGSGMHMLPVNLNLDLQQAFTERRAE
AYERLLIDVIRGRLTHFMRRDELEAAWAWAEPILDGWAKSGERPRNYTAGTFGPAASTAL
MARENAVWAEESQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaacacgcttctgcgactcccgagcttccgctcgacatgatcatcttcggc
ggcaccggcgacctgtcgtttcgcaagctgctccccgcgctgtatatggcgcatttgcat
tgcaacctgccgcccgaaacacgcattctcactatcgggcggaagccctggtcgcgcgag
gaatacatcgccgaattcatggagcagaaggccaagcccttcatcgaaaagaaggcgttc
gacgcggccgcgtgggacaaatttctcgcgctgttcgaatacgtgcgcatggacgtcgat
tcggccgaagactatcagcggctgaaggaagcctcgcgggacggcgtgcgccgcgcgttc
tatctggcgacgtcgccggatctgttcacgaacatctgcgacaacctctccgcggcgggg
ctcgtggacgagctgtcgcgcgtcgtgctcgaaaagccgctcggccatgacctcgcgtcg
gccaaggagatcaacacggcggtcggcaagcatttcagcgaggcgcagatctaccggatc
gaccactatctcggcaaagagaccgtgcagaacctgatggtgctgcgcttcggcaatccg
attttcgggccgctgtggcaggcaccgtatatcaagcgcgtgcagatcacagtcgccgaa
acggtcggcgtgggcagccgtgcaggcttctacgacaagaccggcgcgctgcgcgacatg
gtgcagaaccacctgctgcaactgctgtgcatcgtcgcgatggagccgccggtgtcgctc
gatcccgacgcggtccgcgatgaaaagctcaaagtgctgcgctcgttgcggcccatgacg
cccgaggacatcgcgcgcgacacggtgcgcggccagtacacggcaggcgcggtggacggc
gaggcggtgaagggctatctggaggaagagaatgtgccggccggcagccgtgcggagact
ttcgtcgcgttgcgcgcgcatatcaacaactggcgctgggccaacgtgccgtttttcctg
cgcaccggcaagcgtatgcagaagaaggtgtcggagatcgtcatcgaattctccgatttg
ccgttctccatcattccgagcggcgggcgcaactacggcaaccgtctcgtgatccagttg
cagccggaagaatcgatccagcttcagatgctggcgaaggagcctggcagcggcatgcac
atgctgccggtgaatctgaacctcgacttgcagcaggcgttcaccgagcgtcgcgcggaa
gcgtatgagcgtttgctgatcgacgtgattcgcggacgcctcacgcacttcatgcgccgc
gacgaactcgaggccgcgtgggcctgggccgagccgatcctcgacggctgggcgaagtcg
ggcgagcggccgcgcaactatacggcgggtaccttcgggccggcggcgtcgactgcgttg
atggcgcgggaaaacgccgtatgggcagaggagtcgcaataa

DBGET integrated database retrieval system