KEGG   Paraburkholderia phenoliruptrix: BUPH_06648Help
Entry
BUPH_06648        CDS       T02300                                 

Definition
(GenBank) type IV secretion system protein VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx03070  Bacterial secretion system
Module
bpx_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BUPH_06648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpx02044]
    BUPH_06648
Secretion system [BR:bpx02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   BUPH_06648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: AFT90429
UniProt: K0E3L1
Position
pSYMBR3459:536615..537466
Genome map
AA seq 283 aa AA seqDB search
MVSVIRQWLAAGVGSRKRAPTPRISAAHLEAAARAVDRSQRDAVSWYLDQAREFEKSKME
MAEEKARVADRRSVLSGGIALAAVFGITALGLLKRPNPPAVLRVNDATGKVDVLPTTENG
HVSFTEKTDRADLRRYVEMRESYDWETISDMHSAVMFMSDDHEKDAYDALIRGPAGPLKL
LKDQARIIARVGSITFVGSTAQVFFSRQVIPLNVAAKRPDPTWWIATVAFTRVDVPEKQD
QQDIDPDGFRCTSYEVTRDYTRAPADASPNPAPAASKMPGSGP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtatcggtaatcagacagtggctcgcggctggcgtgggctcgcgcaagcgcgccccg
acgccgcgcatatcggccgcgcacctggaggcagcagcgcgtgccgtcgaccggtcacag
cgtgacgcggtcagctggtatctcgaccaggcccgggagttcgagaagtcgaagatggag
atggcggaagaaaaggcgcgcgtcgccgaccggcgatcagtgctctcgggtggcatcgcc
ctcgcagctgtttttggcataacagctttaggactacttaaaagacccaatccaccggcg
gtgttgcgggtgaacgacgcgaccggcaaggtggatgtgctgccaacgaccgagaacggc
cacgtgagcttcactgaaaaaaccgaccgcgcggacctgcgccgctatgtcgagatgcgc
gagagctacgactgggagacgatttcggacatgcacagcgcggtgatgttcatgagcgac
gatcatgaaaaggacgcttatgacgcgctcatccgtggaccggccggcccgctcaagctg
ctcaaagaccaggcgcgcatcatcgcccgggtcggctcgatcacctttgtcggttcgacg
gcgcaggtgttcttctcacggcaggtgatcccgttgaatgtggcggcgaagcgcccggac
ccgacctggtggattgcgacggtggccttcacgcgcgtcgatgtgccagagaaacaggat
cagcaggacatcgatccggacgggtttcggtgtaccagttacgaggtcacacgcgattac
actcgcgcgccagcggatgcatcgcccaatcccgcaccggccgcatcgaagatgcccggg
agcgggccatga

DBGET integrated database retrieval system