KEGG   Paraburkholderia phenoliruptrix: BUPH_08387Help
Entry
BUPH_08387        CDS       T02300                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00360  Phenylalanine metabolism
bpx00362  Benzoate degradation
bpx00620  Pyruvate metabolism
bpx00621  Dioxin degradation
bpx00622  Xylene degradation
bpx00650  Butanoate metabolism
bpx01100  Metabolic pathways
bpx01120  Microbial metabolism in diverse environments
bpx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_08387
   00650 Butanoate metabolism
    BUPH_08387
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BUPH_08387
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUPH_08387
   00622 Xylene degradation
    BUPH_08387
   00621 Dioxin degradation
    BUPH_08387
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BUPH_08387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Shikimate_DH Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFT90391
UniProt: K0DW61
Position
pSYMBR3459:500185..501069
Genome map
AA seq 294 aa AA seqDB search
MSNSRTNVAIIGSGTIGTDLMCKVLVSESLNLAFVAGRDPNSRGLAVAKERGVETSADGI
NFLKAHRNAYDIVFDATSAHAHVDHNTVFSACGKFAIDLTPAAIGMACVPSVNLTDVAGQ
QNVSLVTCGGQASLPLAHALRHATEQIDYLEVVSTIAAASAGTATRENINNYLTTTERAL
SLFSGANKVKAILNINPAEPGVMMQTTIYAYAKCGDFSEIEGAISKAAASVQEYVPGFQI
ALAPIMDAGRITVSVKVQGSGHHLPSYAGNLDIINCAAVAVAAHSGRLTRSRQS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattcacgcacgaacgtagccatcattggatcaggaacgatcggtaccgatcta
atgtgcaaggttctcgtgtcggaaagcttgaaccttgcgtttgtggccggacgcgatcct
aatagccgcgggctcgccgttgcgaaagagcgtggcgtcgagacgtcggcggacggcatc
aatttcctgaaagcgcaccgcaatgcatatgacatcgtcttcgatgcgacctccgcccat
gcgcacgtcgaccacaacaccgttttttctgcatgcgggaaatttgccatcgatctgacg
ccggctgccattggtatggcgtgtgtgccatcggtcaatctcaccgacgtcgccgggcag
caaaacgtcagtctggtgacttgcggcggacaggcgagtttgccgctcgctcatgccctt
aggcacgcgacggagcaaattgactacctagaagtcgtttcgacaatagcggcggcaagc
gccggaacggcgacgcgggaaaatatcaacaattaccttactaccaccgagcgggccctg
tctctcttctcgggagcgaacaaggtgaaggcgattctaaatatcaatcctgcggaaccg
ggcgtaatgatgcaaacgacgatctacgcttacgcgaaatgcggtgacttttccgaaatc
gagggcgcgatcagtaaggccgccgcttccgtacaggaatacgtccccggctttcagatc
gcgctcgcgccgattatggatgcaggacgaatcactgtcagcgtgaaggtgcaaggcagc
ggacatcatctaccgagctatgcaggcaatctcgacatcatcaattgcgcggctgtcgcg
gtagcggcgcacagcggccgtcttacgaggagcaggcaatcgtga

DBGET integrated database retrieval system