KEGG   Paraburkholderia phytofirmans: Bphyt_0073Help
Entry
Bphyt_0073        CDS       T00765                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00860  Porphyrin and chlorophyll metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
Module
bpy_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_0073
Enzymes [BR:bpy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bphyt_0073
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Bphyt_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_2 DAO HI0933_like Thi4 Pyr_redox FAD_binding_3 FAD_oxidored GIDA Lycopene_cycl AlaDh_PNT_C Pyr_redox_3 MCRA NAD_binding_7 Trp_halogenase ApbA
Motif
Other DBs
NCBI-ProteinID: ACD14523
UniProt: B2SZE4
Position
1:91180..92604
Genome map
AA seq 474 aa AA seqDB search
MDTSLDDRPAMAAAARQDGNGPRVIVIGSGIAGLTAAYRLGQAGMHVTVLEAAETVGGRM
GDRREGDIVFNSGARLVYPFGGAFNRLVADLALGDALVPLRRLSARCVTTKGDHLIELMP
TVRSLATPGLHLGERVAMVRHALRMRSQRDRVDPDWAISALDVDPEADRLNLADYIRREI
GPNAMSYLVEPVFRATRSFNPDALSTLFYRTTVPHLIGEDTVHTLKGGMGQVCRTLAGLL
DVRTGTRVTSVEHQRDGDELRLRVTLANGDALTADHVVCAVQGSLARELIRTPQAIERQM
LANVHYNALGVVHYGFAKSLPAQMQFASRDVGSRIATFQQTPAAPDQGRPLTQVYCQLAP
EAVDEAIRRGCTGELDVLLREELRARIPDFDRQVVAVVNQWIPRMLPLFAPGYGGRLRAF
WRWQEAPAQASGRPVVYCGDWTSQALLTGACASGERAARIVLARSQVVSGRAQS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggacacatctctggatgatcgaccggcgatggcggcggcagcgcgccaggacggcaat
ggcccccgcgtgattgtgatcggttcgggaattgcggggctcacagctgcctatcggctt
gggcaggcgggcatgcatgtaacggtactggaggccgcggaaacggttggcggtcgcatg
ggagaccggcgcgaaggcgatatcgttttcaacagcggcgcgcgcctcgtctacccgttc
ggcggtgcgttcaatcgtctggtcgccgacctcgcacttggcgatgcgctcgttccacta
cgccgtctgagcgcgcgctgtgtgacaacgaaaggggaccatctgatcgagttgatgccg
actgtacgctcgctggcgacgccggggttgcatctaggggagcgggtcgcgatggtgcgg
catgcgttacggatgcgttcgcagcgcgaccgcgttgatccggactgggcgatcagtgcg
cttgatgtcgacccggaggccgaccggctgaacctcgccgattacattcgcagggagatc
ggtccaaatgcgatgtcatacctggttgaaccggtgtttcgcgcgacgcgcagcttcaat
cctgatgcgttatcaaccctgttctaccgcaccaccgtgccgcatctgatcggcgaggat
acggtccacacccttaaaggtggtatgggacaggtatgccggacacttgccgggttgctg
gacgtgcggaccggaacgcgggtgacttccgtcgagcaccagcgcgatggcgatgagctt
cgtctcagggtcacgcttgcgaacggcgacgccttgactgccgatcacgtggtctgcgcg
gtccagggctcactcgcgcgggaattgatccgcacgccacaggctatagagcgccagatg
ctggccaatgtgcactacaacgcccttggtgttgtccactatggattcgcaaagtccctc
ccagcgcagatgcaattcgcttcgcgcgatgtcggaagccgtatcgcaacgtttcaacag
acgccggctgcgcccgatcaagggcgcccactcacgcaggtgtattgccagctggcgcca
gaggcagtggacgaagcaatcaggcgcggctgcaccggcgaacttgacgtgttgctgcgc
gaagagttacgtgcccgcattcccgacttcgaccggcaggtggtcgcggtcgtcaatcag
tggataccccggatgctgcctttgttcgccccggggtacggggggcgcctgcgcgccttc
tggcgttggcaggaggcgcctgcgcaggcctccgggcggcctgtcgtgtattgcggggac
tggacatcgcaggcgctgctcaccggcgcgtgtgcgagcggtgagcgggctgccagaatt
gtgctggcccggtcacaggtagtgtccggtcgcgcgcaaagttag

DBGET integrated database retrieval system