KEGG   Paraburkholderia phytofirmans PsJN: Bphyt_0162
Entry
Bphyt_0162        CDS       T00765                                 

Definition
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
bpy  Paraburkholderia phytofirmans PsJN
Pathway
bpy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bphyt_0162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_0162
Secretion system [BR:bpy02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bphyt_0162
SSDB
Motif
Pfam: VirB3 BioT2
Other DBs
NCBI-ProteinID: ACD14601
UniProt: B2T040
Position
1:175479..175811
AA seq 110 aa
MNPAANRLVDPVFKGCTRPAMLWGVPLVPFLMVGGSILIPAIWALLASPPAGVGIVLLLI
PVFVTMRAVTRHDDQRLAQLALRLRMVVRQRNRGFWCAHAYTPLRLKRRG
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaatccggccgcaaaccgactcgtggatcctgtcttcaagggctgcacgcgccccgcg
atgctctggggtgtaccgctcgtgcccttcctcatggtgggcggcagcatcctgataccc
gcgatctgggcgctactcgcgagcccgccagcaggcgtcggcatcgtgctgctcctgatc
cccgtcttcgtcacgatgcgcgcggtcacgcgccatgacgaccagcgcctggcgcaactc
gcattgcggctgcgcatggtggttcgccagcgtaaccgtggcttctggtgcgcgcatgcc
tacacgccgctgcgcctgaagaggaggggctga

DBGET integrated database retrieval system