KEGG   Paraburkholderia phytofirmans: Bphyt_0461Help
Entry
Bphyt_0461        CDS       T00765                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00071  Fatty acid degradation
bpy00072  Synthesis and degradation of ketone bodies
bpy00280  Valine, leucine and isoleucine degradation
bpy00310  Lysine degradation
bpy00362  Benzoate degradation
bpy00380  Tryptophan metabolism
bpy00620  Pyruvate metabolism
bpy00630  Glyoxylate and dicarboxylate metabolism
bpy00640  Propanoate metabolism
bpy00650  Butanoate metabolism
bpy00900  Terpenoid backbone biosynthesis
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01200  Carbon metabolism
bpy01212  Fatty acid metabolism
bpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphyt_0461
   00630 Glyoxylate and dicarboxylate metabolism
    Bphyt_0461
   00640 Propanoate metabolism
    Bphyt_0461
   00650 Butanoate metabolism
    Bphyt_0461
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bphyt_0461
   00072 Synthesis and degradation of ketone bodies
    Bphyt_0461
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bphyt_0461
   00310 Lysine degradation
    Bphyt_0461
   00380 Tryptophan metabolism
    Bphyt_0461
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bphyt_0461
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphyt_0461
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bphyt_0461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpy04147]
    Bphyt_0461
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bphyt_0461
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphyt_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5417
Motif
Other DBs
NCBI-ProteinID: ACD14886
UniProt: B2SWU2
Position
1:complement(512101..513294)
Genome map
AA seq 397 aa AA seqDB search
MSETKGDPIVIVGVARTPMAAFQGDFAALTAPQLGSVAIEAAVKRAGLKPEQVDEVVMGC
VLPAGLGQAPARQAALGAGLPLATGSTTVNKMCGSGMRAAMFAHDMLAAGSVDVIVAGGM
ESMTNAPYLLPKARNGMRMGHGQVIDHMFYDGLEDAYEKGRLMGTFAEECAASFDFTREA
QDAFAVESLNRAKRANEDGSFGWEIAPVKVESRKGDVTIDRDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRESTARRLGVEPIARVVGHSTFAQEPAKFTTAPVGA
IRKLFEKNGWRADEVDLYEVNEAFAVVTMAAMKEHHLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALKKRGLKRGVATLCIGGGEATAMGIELV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagacaaaaggtgatccgatcgtcatcgtgggcgtggctcgcacgccgatggcg
gcatttcaaggcgacttcgccgcgctgacagcgccgcagttgggctcggtggcaatcgaa
gcggccgtgaaacgcgcgggcttgaagcccgaacaggtcgacgaagtggtaatgggctgc
gtgctgcccgctggcctcggtcaggcgcccgcgcgtcaggccgcgctcggcgcgggcttg
ccgctcgccaccggcagcaccacggtaaacaagatgtgcggctccggcatgcgcgcggcc
atgttcgcgcacgacatgctcgcggcgggctccgtcgatgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccctatctgctgcccaaagcacgcaacggcatgcgcatgggc
cacggtcaggtgatcgaccacatgttctacgacggccttgaagacgcctacgaaaaaggc
cgtctgatgggcaccttcgccgaggaatgcgcggcgtcgttcgatttcacgcgcgaggcg
caggacgcgttcgccgtcgagtcgctcaatcgagcgaaacgcgccaacgaagatggttcg
ttcggctgggagatcgcaccggtgaaggtggagagccgcaagggcgatgtcaccatcgat
cgcgatgagcagccgttcaaggcgaatcccgaaaaaattccgacgctcaaacccgcgttc
agcaaaaccggcacggtgacggcggcgaactcgtcgtcgatttccgacggcgcggccgcg
ctcgtcatgatgcgcgaatcgacggccaggcgtctcggcgtcgagccgatcgcgcgcgta
gtgggccactcgaccttcgcgcaggaaccggcgaagttcaccaccgcgccggtcggcgcg
attcgcaagctgttcgagaagaacggctggcgcgcggatgaagtcgatctgtatgaggtc
aacgaagcattcgccgtggtgacgatggcggccatgaaggaacaccatctgccgcacgag
aaggtcaatgtgaatggcggcgcctgtgcgctcggccatccgatcggcgcgtcgggcgcg
cggattctggtcacgctgatcggcgcgctgaagaaacgtggactgaagcgcggcgtcgcg
acgctgtgcatcggcggcggcgaagcgacggcgatgggtatcgaactggtgtaa

DBGET integrated database retrieval system