KEGG   Paraburkholderia phytofirmans: Bphyt_0484Help
Entry
Bphyt_0484        CDS       T00765                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00071  Fatty acid degradation
bpy00280  Valine, leucine and isoleucine degradation
bpy00281  Geraniol degradation
bpy00310  Lysine degradation
bpy00360  Phenylalanine metabolism
bpy00362  Benzoate degradation
bpy00380  Tryptophan metabolism
bpy00410  beta-Alanine metabolism
bpy00627  Aminobenzoate degradation
bpy00640  Propanoate metabolism
bpy00650  Butanoate metabolism
bpy00903  Limonene and pinene degradation
bpy00930  Caprolactam degradation
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01212  Fatty acid metabolism
Module
bpy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bphyt_0484
   00650 Butanoate metabolism
    Bphyt_0484
  Lipid metabolism
   00071 Fatty acid degradation
    Bphyt_0484
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bphyt_0484
   00310 Lysine degradation
    Bphyt_0484
   00360 Phenylalanine metabolism
    Bphyt_0484
   00380 Tryptophan metabolism
    Bphyt_0484
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bphyt_0484
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bphyt_0484
   00281 Geraniol degradation
    Bphyt_0484
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphyt_0484
   00627 Aminobenzoate degradation
    Bphyt_0484
   00930 Caprolactam degradation
    Bphyt_0484
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bphyt_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACD14909
UniProt: B2SWW1
Position
1:537793..538680
Genome map
AA seq 295 aa AA seqDB search
MSQAPHRNDAFYARYQSLQLHRHPHGVLEVVMSGEGANKSALATANARMHFELAEIWRDI
DRDPDTRVAIIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREARDLVYNVINCSKPVVS
AMHGPAVGAGLVAGLLADISIATKTARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYL
MLCEPVSGEEAERIGLVSLAVDENDLLPKAFEVAQKLADGSQTAIRWTKYALNNWLRSAG
PAFDTSLALEFMGFAGPDVREGVNSLRERRAPDFGGADPWRGQPSSGGATGGEGS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggcacctcaccgtaacgacgcgttttacgcgcgttaccagtcgctccagttg
catcgccatccgcacggcgtgctcgaagtcgtgatgagcggcgagggcgcgaacaagagc
gcgctcgccaccgccaacgcgcgcatgcacttcgaacttgcggagatctggcgtgacatc
gaccgcgatcccgacacgcgcgtggcgatcattcgcggcgaaggcaagggcttttcggcc
ggcggcgacctgcaactcgtcgaagacatggccactgatttcgacgtgcgcgcgcgagtg
tggcgtgaggcgcgcgatctggtctacaacgtgatcaattgcagcaagccggttgtttcg
gccatgcacgggccggcagtcggtgccgggctcgtggcggggctcctcgccgacatttcg
atcgcgacgaagacggcgcggatcatcgacggccatacgcgtctgggcgtggccgccggc
gatcacgcggcgatcgtctggccgctgctgtgcgggatggcgaaagccaagtattacctc
atgctgtgcgagccggtgagcggcgaggaggctgaacgcatcggcctcgtctcgctcgcc
gtcgacgaaaacgatctgctgcccaaagcattcgaagtcgcgcagaagctggccgacggc
tcgcaaacggcgattcgctggaccaagtacgcgttgaacaactggctgcgctcggcggga
ccggcgttcgatacgtcgctcgcgctggaattcatgggctttgccggccctgatgtgcgc
gaaggcgtgaactcgctgcgcgagcggcgcgcgccggatttcggcggcgcggacccgtgg
cgcggtcagccgtcgagcggcggcgcgacaggcggcgagggctcctga

DBGET integrated database retrieval system