KEGG   Paraburkholderia phytofirmans: Bphyt_0586Help
Entry
Bphyt_0586        CDS       T00765                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00900  Terpenoid backbone biosynthesis
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bphyt_0586
Enzymes [BR:bpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bphyt_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACD15011
UniProt: B2SXG6
Position
1:complement(636794..637675)
Genome map
AA seq 293 aa AA seqDB search
MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGDTLHFTRRDDGLITRS
TEIADVPPEHDLTVRAATLLKAHTGSPEGVDIEIDKRLPMGAGLGGGSSDAATTLLALNR
LWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVVQLPPRHFLVVTPRVHVP
TAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQQVVVGKYAEVAQVLRWFE
NVAPARMSGSGASVFAAFRSKAEAEAAQAKLPAEWNSAVTASLDQHPLFTFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacgaccgattcgctgcgcgattgcctcgctccagcgaaactcaacctcttc
ctgcacatcaccggccgccggcctgatggctatcacacgctgcaaacggtcttccagttg
ctcgactggggcgacacgctgcacttcacgcgacgtgacgacggactcatcacgcgcagc
accgaaatcgccgacgtgccgccggaacacgacctgaccgtgcgcgccgcgacactgctc
aaagcgcatacgggctcgcctgaaggcgtcgatatcgaaatcgacaagcggctgccgatg
ggcgccggccttggcggcggcagctctgatgctgcgacgacgctgctcgccctgaatcgt
ttgtggaagctcaatctgccgcgcctcgaattgcaggcgctggcattgaaacttggcgcc
gatgtgccgttttttgttttcggaaaaaatgcgttcgcccagggtgtcggagaagcttta
gacgttgtacaattgccgccgcgccatttcttagtagtgacgccgagggttcatgttccg
actgcagcgattttttctgaaaaagcgttgacaagagattcaaaacccctcacaattacg
gactttcctgcagaacttagctgcaacactgaatggccagaaagtttcggccgcaatgac
atgcagcaggttgtcgtaggaaaatacgcggaagtagcgcaagtgttgcgatggtttgaa
aacgtcgcgccagcgcggatgtctggatcaggtgcaagtgtttttgccgcgttccgcagt
aaagctgaagcagaagcggcgcaagccaaactgccagccgaatggaacagcgcagtgact
gcaagtctcgatcagcatccactctttactttcgcgtcataa

DBGET integrated database retrieval system