KEGG   Paraburkholderia phytofirmans: Bphyt_0934Help
Entry
Bphyt_0934        CDS       T00765                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bphyt_0934
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_0934
Secretion system [BR:bpy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphyt_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACD15353
UniProt: B2T0Q1
Position
1:complement(1048323..1052312)
Genome map
AA seq 1329 aa AA seqDB search
MKKLSFLVSRWFLAFLALLVLGLLIWFLGPFVAFGGLKPLVSVGMRVLVIALLLVGALLW
LKGWSTGVVFGALLCLLVWYAGPLLSFGRAAPLTSVAARVIAIGVVLALFAAFGLYWLWQ
KMRSDEAFLKKALTFGGKKETPPAAGRLKEVEARINAALARLKSMRTGARGVGRLFQGTR
YLYELPWFIALGSTSSGKTSALLNAGLAFPIGGATPRTAGASVGTKNIDWWLSNDAVLID
TAGYYTRHGASTQSLPALADKRAENKDDNKDDNAGCGTAATQGTDAAVGDADWRRRVDED
EWHGFLDLLRRHRPRAPINGAVLAISLDILTASDPAVRATEADMLRERLADLRTRLGIRF
PVYLMITQMDRLSGFADYFGSLTEEHRAQMWGFTLPVNGQSARSDLAAVCNGELRQLVTR
LAGGVNTRLEDEYDIERRRRLAALPEAFAALCAPLAELLGQLFVDSRYDATQNHTMLRGV
YFTSALQAGQTVTAEPLTVVQRLMAGRSRLFSADAARPAANHSYFLHDLFTKVVFPEAHL
VRPNLRWEYRFRLLRLLGHTLGLVLFVWLAMGMRVSFGNNSDYLDAIARKSQALAAKVTQ
LYREPKPEAVPDTLGEARYLPTWTGLDLSDPDSRFRYGLYSAPGVVEASRDTYRALEDNL
LLPSIVHRLEDVIAESMANKDAKATYGALRVYLMLYDKARFNSTDIKAWVLDDWAKNDSA
SIFGGRASMIEHVEQLFSGERIVQSPLIRNDGLIQQARAFLDGSNATQRLYERAKADMQK
EAPDEFTLLRAVGPQAGTVFTRVSGAPLSRGVPGLFTFDGYQNLFDKRLPEFVQAARDDD
AWVMGRSYLGEAQKKTAEIVSTVTGADDPLTEAIRRLYLTEYAQQWDAFLGDIRTVAGTS
LAFNLQVLRQFAAPDSPLARLARAAVHETTLTQSIAAANGSLLQKTTDQFSQKADKALGI
RAEERVERELVDGHFAALREMVTGSADTSAAEAPANAQAGKTGLDGVTSLLNDYYTTLTV
ADNAIANNSMPPASDAAAKLKMAANTMLAPFRDVLLGLSVQGSREVNQGIGQLLSRQMQA
VVSDTCRMTVEGNYPFAPDSPRDVSVDDFTRVFAQGGVIDDFFTKNLAPFVDTSAKPWRY
RTLPGATDPVRGPDLEPFQHARQIRDVFFGDQGKQLLWKTDIRVPELDPTVTTLAIDIDG
QTMLYQHGPVAPFAVSWPGPRGGVHAEMTASPRIRNETSTLVTDGPWALMRLLRKGQIVQ
TATPGRTRAEFDFDGRKAVLDITGAGSVANPLTSEVLTTFRCPNSMSMFSLPDSGPPPGL
PAADADRAH
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttgtcgtttctggtatcgcgctggttcctcgcgttcctcgcgctgttggtc
ctcggactgttgatctggtttctggggccgttcgtcgcgttcggcggcctcaagcctctt
gttagcgtcggcatgcgcgtcctcgtgatcgcgctgctgctcgtgggcgcgctgctctgg
ctcaagggctggtcgaccggcgtggtgttcggtgcgctgctgtgcctgctggtctggtac
gcagggccgctgttgagcttcgggcgtgccgcgccgttgacctccgtcgcggcgcgcgtg
atcgccattggcgtcgtgctggcgctttttgccgcattcggtctgtactggctctggcag
aaaatgcgcagcgacgaagcgttcctcaaaaaagcgctgacgttcggcggcaagaaggag
acgccgccggccgccggcaggctcaaagaggtcgaggctcgcatcaacgccgcgctcgcg
cggctgaagtccatgcgcacgggcgcgcgaggcgtggggcggctcttccagggcacgcgg
tatctgtacgagctgccctggttcatcgcgctcggctcgacctcctccggcaagacgagt
gcattgctgaacgccgggctggcgtttccgattggcggcgcgacgccgcgaacggccggc
gcatccgtcggcacgaagaacatcgactggtggctgtcgaacgatgccgttctgatcgat
accgcgggctactacacgcgacatggcgcatcgactcagtcattgcccgcgctcgcggac
aaacgcgccgaaaacaaagacgacaacaaagacgacaacgccggctgcggcacggccgca
actcagggcacggatgccgcagtgggcgatgccgactggcgtcggcgtgtggacgaagac
gaatggcatggctttctcgacctgcttcgccgtcaccgcccgcgcgcgccgatcaacggc
gcggtgctcgcaatcagcctcgacatactgacggcctccgaccccgcggtgcgcgcgacc
gaagccgacatgctgcgcgaacggctggccgatttgcgcaccaggctgggtatccgcttt
ccggtgtacctgatgatcacgcaaatggaccgtttgtccgggttcgccgattatttcgga
tcgctgaccgaggaacatcgcgcgcagatgtggggattcacgctcccggtcaacggccaa
tcggcccggagcgatctcgctgcggtgtgcaacggagaactgaggcagcttgtcacgcgt
ctcgccggcggcgtgaacacgcggctggaagacgagtacgacatcgagcgccgccggcgc
ctcgcggcactgccggaagcgttcgccgcgctctgcgctccgcttgccgagttactgggg
caactgttcgtcgattcacgttacgacgctacgcaaaatcacacgatgctacgaggcgtc
tatttcacgagcgcattgcaggccgggcaaacagtcactgccgaaccgctcacggtcgtg
cagcgtctgatggcggggcgcagtcgcctgttctcggcggacgcggcgcggcccgccgcg
aaccacagctattttttgcacgatctgttcacgaaggttgtctttcccgaagcgcatctg
gtgcggcccaatctgcgctgggagtaccgtttccgcctgttgcggctgctcgggcacacg
ctcggcctcgtattgttcgtgtggctcgcaatgggcatgcgcgtgagcttcggcaataac
agcgactatctggatgcgatcgcgcgcaagagccaggcactcgcggccaaggttacgcag
ctttaccgcgagcccaaaccggaagccgtgccggacacgttgggcgaggcgcgctatctg
ccgacctggacaggactggatctgtcggatcccgacagccgctttcgctatggcctctac
agcgcgccgggtgtcgtcgaggcgagccgcgacacctatcgcgcgctcgaggacaatctg
ctgctgccgtccatcgttcaccgcctcgaagacgtcattgctgagtcgatggcgaacaag
gatgccaaagcgacctacggcgcgttgcgcgtctacttgatgctgtatgacaaggcgagg
ttcaactcgaccgatatcaaagcctgggtactcgacgactgggcaaaaaacgacagcgcg
tcgatcttcggcggacgggcttcgatgatcgaacacgtcgagcagttattttccggcgag
cgtatcgttcagtcgccgctgatccgcaacgacggcctgattcagcaggcccgcgcattt
ctcgacggcagcaatgccacgcagcggctctacgagcgcgcgaaggcggacatgcagaag
gaggcgcccgacgagttcacgctgcttcgcgcggtcggaccgcaggccggcacggtgttc
acgcgtgtcagcggcgcaccgctctcgcgcggtgtgccgggcctctttacgttcgacggc
taccagaacctgttcgacaagcggctgccggagttcgtccaggcagcgcgcgacgacgac
gcctgggtcatgggacgttcgtatcttggcgaggctcaaaaaaaaacggctgaaatcgta
agcacggtaacgggcgccgacgatccgctgacggaagccatccgccggctctatctgacc
gaatacgcgcagcaatgggacgctttcctcggcgatatccgcacggtcgccggtaccagc
cttgccttcaatctgcaggtgctgcgccagttcgctgcacccgattcgccgctggcgcgc
ctcgctcgcgcagccgtgcatgaaacgacgctcacccagtcgatcgccgccgccaatggt
tctctgctgcagaaaacgaccgaccagttcagtcagaaagcggataaggcgctgggcatc
cgcgcggaagagcgcgtcgagcgcgaactggtggacggccatttcgccgcgctgcgcgag
atggtcacaggcagcgccgacacctcggccgccgaggcgccggccaatgctcaagccggc
aagacaggtctcgacggcgtaacgagcctgctcaacgattactacaccacactgacggtc
gcggataacgcgatcgcgaacaacagcatgccgcccgccagcgatgccgcggcaaaactg
aaaatggcggccaacaccatgctggcgccctttcgcgacgtgttgctcggcctctcggtg
cagggttcgcgcgaagtcaatcagggcatcgggcaactgctttcgcggcagatgcaggcc
gtggtcagcgatacgtgccgaatgaccgtggagggcaactatccttttgcgccggacagt
ccgcgcgacgtgagtgtcgacgacttcacacgcgtattcgcacagggcggcgtgatcgac
gacttcttcacgaagaacctcgcaccgttcgtcgatacctcggcgaagccgtggcgctac
agaacgctgccgggcgccaccgatcccgtacggggccccgacctcgaaccattccagcac
gcgaggcaaatccgcgacgtgttcttcggcgaccagggcaagcaacttctttggaaaact
gacatccgcgtgcccgaactcgatccgaccgtgacgacgctggcaatcgacatcgacggt
cagaccatgctgtatcagcacggacccgtcgcaccattcgcggtgagctggcctgggccg
cgcggcggcgtgcatgccgaaatgaccgcgagcccacgcattcgcaatgaaacctcgacg
ctcgtgacggacggcccgtgggcactcatgcgtttgctgcgcaaggggcagattgtccag
acggccacgccggggcgcacccgcgcggagttcgatttcgacggacgcaaggcggtgctc
gatatcaccggtgcgggcagcgtcgccaacccgctgaccagcgaagtgctcacgaccttc
cgttgcccgaattcgatgtcgatgttcagcctgcctgacagcgggccgccgcccggcttg
ccggcggcggatgccgaccgcgctcattga

DBGET integrated database retrieval system