KEGG   Paraburkholderia phytofirmans PsJN: Bphyt_0946
Entry
Bphyt_0946        CDS       T00765                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bpy  Paraburkholderia phytofirmans PsJN
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_0946
Secretion system [BR:bpy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphyt_0946
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACD15365
UniProt: B2T108
Position
1:1064498..1066387
AA seq 629 aa
MDPRLLDYYNQELMYVRELAGEFAQLHPKIARRLGMQAGEMTDPYVERLIESFSFMAARM
QLKLDAEFPRFTGRLLEVIYPNYVAPTPSMAVARFYPSPSEGNLVEGFPVRRGSMLTGKK
SPGENTLCEFRTGQDVALYPLEITHAQLTGIPPDIPMLDRYVPPHTQVRGALRLRLRSTG
DAKIAELRGLDRLPVYLAGDEQVASHLFELLHAAGVASITGEPGRFGDAARPFCAVTHGA
VAHEGLGVDQGLLPLTWSKFHGHNLLHEYFACPSRFYFFTLTGLREGLSKAKGHEVEIVV
LLDQSPDRLIGLVDASRFALFCTPVINLFPRKAQRIELNQASTEFHLVPKRSAPLDYEVY
SVEALTAQVGKNSTEFAFRPLYQTLNNDEGNHGRYFSLRRERRLLSDSARRYGTRTPYIG
TEVFVSLVDQQEAPYHEGMRYLSIDAWLTNRDLPNLLPRNGVDDLDAVDSVPAISVGLIR
APSAPRAPFAERETAWRLIRQLNFNYLPLEDMDHRPGGQGVRDMLRLFLTGDDVGPRRQV
ESLVGVKTRPVARKLPGGGPLVFGRGIECQLTVDETGFSGLSPYLFGVILEHYLARHVSI
NSFTQTELHSMQRGQLMRWPVRMGTRGVA
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggatccgcgactgctcgattactacaaccaggaactgatgtatgtacgcgaactggct
ggcgagttcgcgcaactgcatccgaagatcgcgcggcggctcggcatgcaggccggcgag
atgaccgatccgtacgtcgaacggctgatcgagtcgttcagcttcatggcggcgcgtatg
cagctcaagctcgacgcggaattcccgcgcttcacgggacgtctgctagaggtgatctac
ccgaactatgtggcaccgacgccgtccatggcggtcgcgcgcttctatccgagcccgagc
gaaggcaacctcgtcgaaggcttccctgtgcggcgcggcagcatgctcacgggcaagaag
tcgccgggggagaacactttgtgcgaattccgcacgggccaggacgtcgcgctctatccg
ctcgagattacccatgcacaactgacggggattccgccggacattcccatgctcgaccgc
tatgtgccgccccacacgcaagtgcgtggcgcattgcggctgcgattgcgttccacgggc
gatgccaaaatcgccgagctgcgcggactcgaccgactgccggtctatctcgccggagat
gagcaggttgcgtcgcatctgttcgaactgcttcacgcggcaggcgttgcgtcgatcacg
ggcgagcctgggcgtttcggcgacgcggcgcgccccttctgtgcggtcacgcatggcgcg
gtcgcacacgaggggcttggcgtcgatcagggtttgctgccgctcacctggtcgaaattc
catgggcacaatcttctacacgaatatttcgcatgtccgagccgcttttattttttcacg
ctgaccggactgcgcgaagggctcagcaaggcgaaaggccatgaagtcgagatcgtggtg
ctgctcgatcagtcaccggaccggctgatcggccttgtcgacgcctcgcgtttcgcgctg
ttttgcacacccgtgatcaatctgtttccgcgcaaagcgcagcgcatcgaattgaatcag
gccagcacggaattccatctggttccgaagcgcagcgcgccgctcgactacgaagtctat
tcggtcgaagcactcacggcgcaggtcggcaagaactcgacggaattcgccttccggccg
ttgtatcaaacgctgaacaacgacgaaggcaaccacgggcgctatttttcgcttcgccgc
gaacgccggttgttatctgactcggcccgccgctacggtacgcgcacgccgtacattgga
actgaagtgttcgtgtcgctggtcgaccagcaggaagcgccgtatcacgagggaatgcgc
tatctgtcgatcgacgcctggctgaccaatcgcgacttgccgaatctgttgccgcgcaac
ggcgtggacgatctggacgccgttgactcggtgcctgcgatcagcgtcggcttgattcgt
gcgccaagcgcgcctcgcgcgccgtttgccgagcgcgaaacagcttggcggcttatccgg
caactgaacttcaactatttgccgctggaagatatggatcaccgccctggcggccagggt
gtgcgcgacatgctgcgcctgttcctgaccggcgacgacgtgggaccgcggcgtcaggtg
gaaagcctcgtcggcgtgaagacgcggccggtcgcgaggaagctgcccggtggcggcccg
ctggtgttcggtcgcggcatcgaatgtcagttgacggtcgatgaaaccggcttttccggt
ttgagcccctacctgttcggggtgattctcgagcactatctggcacggcacgtatctatc
aattcgttcacgcagaccgagcttcattcaatgcagcgcggccagttgatgcgctggccc
gtgcgcatgggcacacgtggagtggcttga

DBGET integrated database retrieval system