KEGG   Paraburkholderia phytofirmans: Bphyt_2469Help
Entry
Bphyt_2469        CDS       T00765                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00300  Lysine biosynthesis
bpy01100  Metabolic pathways
bpy01120  Microbial metabolism in diverse environments
bpy01230  Biosynthesis of amino acids
Module
bpy_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bphyt_2469
Enzymes [BR:bpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bphyt_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACD16865
UniProt: B2T5K8
Position
1:2785474..2786613
Genome map
AA seq 379 aa AA seqDB search
MSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGVDGT
AGKLLAFAGHTDVVPTGPLEQWRSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVA
AHPAHRGTIAFLITSDEEGPATDGTVKVVEALQERGERMDYCIVGEPTSSAQFGDMVKNG
RRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNI
HSGTGATNVIPGHADVMFNFRFSTASTVEGLQARVHAILDKHGLEYDLQWTVSGLPFLTP
RGDLSNALAKAIKDETGLNTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEV
AHIEPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccctcgcccttaccgaacaactgatcgcgcgcgcgtccgtcacgcccgac
gaccagcattgccagcgcctcctgatcgagcgcctcgccgcactcggcttcgagcacgag
accatcgaatcgaacggcgtgaccaacctgtgggccgtcaaacgcggcgtcgacggcact
gcggggaagctgctcgcgttcgccggccacactgacgtggtgccgaccggcccgctcgaa
caatggcgctcggcgccgttcgagccgacccatcgcgacggcaaactttacggccgcggc
gcggcggacatgaaagcgtcgatcgcgggcttcgtggtggcgagcgaggagttcgtcgcc
gcgcacccggcgcaccgcggcacgatcgccttcctgatcacgagcgacgaagaaggcccc
gccaccgacggcaccgtgaaggtcgtcgaagccttgcaggaacgcggcgagcgcatggac
tactgcatcgtcggcgagccgacttcgagcgcgcagttcggcgacatggtgaagaacggc
cggcgcggttcgatgtcgggcaagctgatcgtcaagggcgtacaaggccatatcgcctat
ccgcatctggcgaagaatccggtgcatctgctcgcgcccgcgctggccgaactggtcgcc
gaacgctgggacgacggcaacgaatattttccgcccaccacatggcaggtgtcgaatatt
cacagcggcaccggcgcgaccaacgtgattccgggccatgcggacgtgatgttcaacttc
cgcttctcgacggcgagcacggtggaaggtctgcaagcccgcgtgcatgcgatcctcgac
aaacacggcctcgaatacgatctgcaatggaccgtgagcgggctgccgttcctcacgccg
cgcggcgatctgtcgaacgcgctcgccaaagccatcaaggacgaaaccggcctgaacacc
gaactgtccaccaccggcggcacttcagacggccgcttcatcgcgcgcatctgcaagcag
gtgatcgagttcggcccgttgaacgccagcatccacaagatcgacgaacatatcgaagtc
gcacacatcgagccgctgaagaacgtgtatcgccgcgtgctcgaacaactgattgcctga

DBGET integrated database retrieval system