KEGG   Paraburkholderia phytofirmans: Bphyt_2821Help
Entry
Bphyt_2821        CDS       T00765                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00260  Glycine, serine and threonine metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphyt_2821
Enzymes [BR:bpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bphyt_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 PTA_PTB
Motif
Other DBs
NCBI-ProteinID: ACD17215
UniProt: B2SZM7
Position
1:complement(3189017..3190048)
Genome map
AA seq 343 aa AA seqDB search
MQHFASDNYAGICPEALDALIAANNSGHEPAYGDDSWTNQVCDRLRELFQTDCEVFFVFN
GTAANSLALASLCQSYHSVICHELAHIETDECGGPEFFSNGSKLLTAPGIGGKLTPDAIE
AVVTRRADIHYPKPKVVTLTQSTEVGTVYSVEEVRAIAAIAKRRHLKVHMDGARFANAVA
ALDVHPSEITWRAGVDVLCFGGTKNGLPVGEAVVFFDRALADDFAYRLKQAGQLASKMRF
ISAPWLGLLDNDVWLRNARHANAMAQLLQTRLQEIPGVSIMFPGESNAVFAQLPAQAAKA
MRARGWKFYEFIGAGGCRLMCAWDTQPETVERFAAEVRELCAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatttcgcgtccgacaactacgccggtatctgtcccgaagcgctcgacgcgctg
atcgccgccaacaacagcggccacgagccggcctacggcgacgattcctggaccaaccag
gtgtgcgaccgtctgcgcgaactgttccagaccgactgcgaagtgttcttcgtattcaac
ggcacggcggccaattcgctggcgctcgcgtcgctgtgccagtcgtatcactcggtaatc
tgccacgagctcgcgcacatcgagaccgacgaatgcggcggcccggagttcttctcgaac
ggctcgaagctgctgaccgcgccgggcatcggcggcaagctcacgccggatgcgatcgaa
gccgtggtcacccgccgcgccgacatccattacccgaagccgaaagtcgtcacgctgacc
cagtcgacggaagtcggcacggtctacagcgtcgaggaagtgcgggcgatcgcggcgatc
gccaaacggcgtcatctgaaagtgcacatggacggcgcgcgtttcgccaacgcggtcgcc
gcgctggacgtgcatccgtcggagatcacttggcgcgcgggcgtcgacgtgctgtgtttc
ggcggcaccaagaacggcttgccggtgggtgaagcggtggtgttcttcgatcgcgcgctg
gccgacgatttcgcttaccgcctgaagcaggccggccaactggcctcgaagatgcgcttc
atttccgcgccctggctcggtctgctggacaacgacgtgtggctgcgcaacgcgcgtcac
gcgaacgcgatggcgcaactgctgcaaacgcggttgcaggaaattccgggcgtgagcatt
atgttccccggagaatcgaacgcagtctttgcgcaattgcccgcgcaagccgccaaggcc
atgcgcgcgcgaggctggaagttctacgaattcatcggcgcgggcggctgccggctgatg
tgcgcgtgggatacgcagccggaaacggtcgagcggttcgccgccgaggtgcgcgagttg
tgcgcggcgtga

DBGET integrated database retrieval system