KEGG   Paraburkholderia phytofirmans: Bphyt_2995Help
Entry
Bphyt_2995        CDS       T00765                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00540  Lipopolysaccharide biosynthesis
bpy01100  Metabolic pathways
Module
bpy_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Bphyt_2995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpy01005]
    Bphyt_2995
Enzymes [BR:bpy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Bphyt_2995
Lipopolysaccharide biosynthesis proteins [BR:bpy01005]
 Unusual sugar
  Bphyt_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 KR NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACD17389
UniProt: B2T625
Position
1:complement(3378748..3379740)
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGSNLVKALNERGEQRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
FRRGDFGKVRAIFHEGACSDTMETDGRYMMDNNFRYSRDVLDVCLAQNIQFLYASSAATY
GGSSRFVEEREVEQPLNVYGYSKFLFDQVIRRVLPTAKSQIAGFRYFNVYGPRETHKARM
ASVAFHNFNQFRAEGKVKLFGEYNGYAAGEQTRDFVSVEDVVKVNLFFFDNPDKSGIFNL
GSGRAQPFNDIASTVVNTLRSLNNEPALSLADQVQRGLIEYIPFPDALRGKYQCFTQADQ
SKLRAAGYDAPFLSVQEGVDRYVRWLFGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgtcaccggcgcggccggttttatcggcagcaatctcgtgaaggcgctc
aacgagcgcggtgaacaacgcatcatcgccgtggacaatctcacgcgcgcggacaagttc
aagaacctcgtggactgcgagatcgacgactacctcgacaagaccgagttcgtcgagcgc
ttcaggcgcggcgacttcggcaaggtacgcgcgattttccacgaaggcgcctgttcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgacgtg
ctcgacgtctgcctcgcgcagaacatccagttcctttacgcgtcctcggcggcgacgtac
ggcgggtcgagccgcttcgtcgaagagcgcgaagtcgagcagccgctgaacgtgtacggc
tactcgaagttcctgttcgatcaggtgatccgccgcgtgctgcctacggcgaagagccag
attgcaggctttcgttacttcaacgtctacgggccgcgcgaaacgcataaggcgcgcatg
gcgtcggtggcgtttcacaacttcaaccagttccgcgccgagggcaaagtcaagctgttc
ggcgaatacaacggctacgccgcgggcgagcagacgcgcgatttcgtctcggtggaagac
gtggtcaaggtcaacctcttcttcttcgacaatccggacaaatcgggcattttcaatctg
ggcagcggccgcgcgcaaccgttcaacgacatcgccagcacggtggtcaacacgctgcgc
tcgctgaacaacgaaccggcgctctcgctcgcggatcaggtgcagcgcgggctgatcgaa
tacattccgttccccgacgcgttgcgcggcaagtaccagtgcttcacgcaggcggatcag
tcgaagctgcgcgcggccggctacgacgcgccgttcctgagcgtgcaggaaggtgtcgac
cgttacgtgcgttggctattcggccaggtgtaa

DBGET integrated database retrieval system