KEGG   Paraburkholderia phytofirmans: Bphyt_3585Help
Entry
Bphyt_3585        CDS       T00765                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bphyt_3585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpy02022]
    Bphyt_3585
Two-component system [BR:bpy02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Bphyt_3585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACD17975
UniProt: B2T6Z2
Position
1:4022036..4022776
Genome map
AA seq 246 aa AA seqDB search
MNPQVLIVDDDPVVRDLLCKFLQSNGFDASVLHDGTHLQRRLERERPSVVVLDIMMPNTD
GLRALTALRAAGDDIPVIFVTARGTVADRIVGLSLGADDYLTKPFDPRELLARIHTVLRR
RGPSTTSAPEARKPYRFGPFELDFATRSLCRDNSKLPLRDSEFALLKIFVNNPYKVLSRV
LIHDLVHRDNLAFRDRSLDVPIWRLRRVIEDDPSNPCYVQTVRGKGYVFVPDADGTPFAD
EAASSA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggtccttatcgtcgacgacgatccggtcgtacgcgatctgctttgcaag
tttctgcagtcgaacggctttgacgcgtccgtgctccacgacggcacacacctccagcgt
cggcttgaacgcgaacggccgtccgtcgtcgtgctcgacatcatgatgccgaacaccgac
ggcttgcgcgcgctcaccgcgttgcgcgccgccggcgacgacattccggtgatcttcgta
acggcgcgcggcacggtggccgaccgcattgtcgggctctcgctcggcgcggacgactat
ctgaccaagccgttcgatccgcgcgaattgctcgcccgcatccacaccgttttgcgccgg
cgcgggccgtccaccacgagcgcgccggaagcccgcaagccgtatcgcttcggcccgttc
gagctcgacttcgccacccgttcgctgtgccgcgacaactccaagctgccgctgcgcgac
agtgagttcgcgctcctgaagatcttcgtcaacaatccgtacaaggtgctgtcgcgcgtg
ctgattcacgatctcgtgcatcgcgacaatctcgccttccgcgaccgcagcctcgacgtg
ccgatctggcgcctgcgccgcgtgatcgaagacgacccgtccaatccctgctacgtgcaa
acggtgcgcggcaaaggctacgtcttcgtgcccgacgccgacggcacgcccttcgccgac
gaggccgcctcaagcgcatga

DBGET integrated database retrieval system