KEGG   Paraburkholderia phytofirmans: Bphyt_3613Help
Entry
Bphyt_3613        CDS       T00765                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00860  Porphyrin and chlorophyll metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
Module
bpy_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_3613
Enzymes [BR:bpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bphyt_3613
Exosome [BR:bpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphyt_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACD18003
UniProt: B2T720
Position
1:4056992..4057990
Genome map
AA seq 332 aa AA seqDB search
MSFYPHHRPRRMRRDDFSRRLMRENILTTNDLIYPVFIVEGSNVRQAVPSMPGVERVSVD
LLMGVAEQCVELGVPVLSLFPAIEPSLKTPDGREATNPAGLIPRAVRELKKNFPELGVLT
DVALDPYTSHGQDGVLDEAGYVINDETVEILVEQARAQAEAGVDIVAPSDMMDGRIGAIR
EMFESEGHVHTRIMAYAAKFASAFYGPFRDAVGSATNLGKSNKMTYQMDPANSNEALREV
QADINEGADMVMVKPGMPYLDIVRRVKDEFQFPTYVYQVSGEYAMLKAAAQNGWLDHDKA
MMESLLAFKRAGADGVLTYFALDAARILRSQK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctatccgcaccaccgtccgcgccgcatgcgccgcgacgacttctcgcgccgt
ctgatgcgggaaaacatcctcaccaccaacgatctgatttatccggtctttatcgtcgaa
ggcagcaacgtgcggcaagccgttccgtccatgccgggcgtcgaacgcgtgtcggtcgat
ctgctgatgggcgtggctgaacagtgtgtcgaactgggcgtgcccgtgctgtcgctgttt
ccggcgatcgaaccatcgctgaaaactcccgatggtcgcgaagcgaccaaccccgccggt
ttgattccgcgcgcggttcgcgaactgaagaagaatttccccgagctgggcgtgctcacc
gatgtggcgctcgacccgtacacgagccacggccaggacggcgtgctcgacgaagccggc
tacgtgatcaacgacgagaccgtcgagattctggtcgaacaggcgcgtgcgcaggctgaa
gcgggcgtcgatatcgtcgcgccttcggacatgatggacggccgcatcggcgcgatccgc
gaaatgttcgagagtgaaggccatgtccacacacggatcatggcttatgcggccaagttc
gcgtcggccttctacggcccgttccgcgacgccgtcggctccgcgacgaacctcggcaaa
agcaacaagatgacctatcagatggatccggccaattcgaatgaggcgctgcgcgaagtg
caagcggacatcaacgaaggcgcggacatggtgatggtcaagccgggcatgccgtatctg
gacatcgtgcgtcgcgtgaaggacgagttccagtttccgacgtatgtgtatcaggtgagc
ggcgagtacgcgatgctgaaagcggccgcgcagaacggctggctcgatcacgacaaggcg
atgatggaatcgctgctggcgttcaagcgggcgggtgccgacggggtgctgacctatttc
gcattggatgccgcgcggatcttgcgttcgcagaagtga

DBGET integrated database retrieval system