KEGG   Paraburkholderia phytofirmans: Bphyt_4913Help
Entry
Bphyt_4913        CDS       T00765                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bpy  Paraburkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_4913
Secretion system [BR:bpy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphyt_4913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: ACD19277
UniProt: B2TC57
Position
2:1038159..1038707
Genome map
AA seq 182 aa AA seqDB search
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVENRLSEAGGKFAVDLRFKSMADFNPDEVVAQIEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLNNTQQLQTLAKDQSNAADQHGGAPDHDKH
GE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaagaaagcattcagaaacgcttgcaaaaagtgcggccgccccgcgttcag
ttgacctatgaggtcgagcgcggcgatgcgatcgaggtgaaggagctgccgttcgtcgtg
ggcgtggtggccgatctggcggggcagtcagaagtcgagcagccgaagctgcgcgatcgc
aagttcgtcaatatcgaccgcgacaacttcgacgacgtgatgaaggcaatcgagccgcgc
gccgcgtttcaggtggaaaaccgcctgagcgaagccggcggcaaattcgcggtcgacctg
cgcttcaagtccatggccgatttcaatccggacgaagtggtcgcgcaaatcgaaccgctg
cggcgcctgctcgaagcgcgttcgaagctcgctgatctgcgcaacaagctggccggcaac
gacaaactcgaagacctgctgagcgaagtgctcaacaacacgcagcagttgcaaaccctg
gcgaaagaccagagcaacgcggcggaccagcacggcggcgcgccggaccacgacaagcac
ggcgaataa

DBGET integrated database retrieval system