KEGG   Paraburkholderia phytofirmans: Bphyt_4917Help
Entry
Bphyt_4917        CDS       T00765                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bpy  Paraburkholderia phytofirmans
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpy02044]
    Bphyt_4917
Secretion system [BR:bpy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bphyt_4917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ACD19281
UniProt: B2TC61
Position
2:1041478..1043316
Genome map
AA seq 612 aa AA seqDB search
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAMSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQLGTSAALSHLTEPVLVERGTELKSRPI
RGVQCRFRTAYDVTLAPIRISEAKYTSVAMAPSATVLPGNATAIISITFESTAAQLDLSA
LKVGKLRTHLHGEQSFIAALADCLFVNGMATYVEADRRGVWKQLRESPVVQAGFDEDDAL
IDYPAKSHPAYRLLTEYFAFPEKFNFADFDLAAMTRESGRCQRLTLHVVLKEVRSDSHMA
RLLDSLAAHHFRLFCTPVVNLFEQHGEPIRISHQAISYPVIAEARRAFAYEVYSIDSVKL
VRQQAHEESVIEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPA
APQTDTLSLDLTCTNRDLPAGLAVGLEGGDLFLEGGSLTGSISMLRRPTPSVRFERGRAA
HWRLISHLALNHVSLANSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQHAAVQWLPGK
PFATFVRGIEIRLTIDEEHFVGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEIL
RCKPRSGESILA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattgctgccgtattacgagcgcgagttatcatttctgcggcgctattcgcgc
gacttcgccgagcgctatccgaagatcgcggcgcgtctggccatgtccggcgagcattgc
gaagacccgcacgtcgagcggatgatcgaatcgttcgcgctgctcggcgcgcgcatcaac
aagaaactcgacgacgattaccccgagtttaccgaagcgctgctggaagtgctttacccg
cactacctgcggccgttcccgtcgtgctcgatcgcgcagttgggcacctccgccgcgctg
agtcatctgaccgaaccggttcttgtcgaacgcggcactgaactcaaatcgcggcccatt
cgcggcgtgcaatgccgtttccgtaccgcttacgatgtgacgttggcgccgatccgcatt
tccgaggcgaagtacacatccgtggcgatggcgccgagtgcgaccgtattgcccggcaat
gccacggcaatcatatcgatcaccttcgaatcgacggcggcgcaactcgatctatcggcg
ctgaaagtcggcaaactgcgcacacacttgcacggcgagcagtcgtttatcgcggcgttg
gcggactgtctgttcgtcaacggcatggccacttacgtggaagccgaccgtcgcggcgtg
tggaaacaactgcgcgaatctccggtcgtgcaagccggtttcgacgaagacgacgcgctg
atcgactatccggccaaatcgcatccggcataccggttgctgaccgaatacttcgcgttc
cccgaaaaattcaacttcgccgacttcgatctggcggcgatgactcgcgagagcggccgc
tgccagcgattgacgctgcatgtcgtgctcaaggaagtgcgcagcgattcgcacatggcg
cgtctgctggattcattggccgcgcatcatttccgcctgttttgcacgccggtggtgaat
ctgttcgagcagcacggtgagccgatccgtatcagccatcaggcaatttcatatccggtg
atcgccgaagcgcgccgcgcgtttgcctacgaggtctattcgatcgattcggtgaaactc
gtcaggcagcaggcgcatgaagaatcggtgatcgagttccggccgttctattcattgcat
catggcgaagcagcgcgcgcgggacattactggtttgcgcggcgcaacgactgggttgca
cagaaaagccccggctacgagactgaaatctctatcgtcgatatcgacttcgaaccggcc
gcgccgcaaacggataccttgagtctcgatctcacctgcaccaatcgcgatttgccggcc
ggtctggcggtagggctcgaagggggcgatctgtttctcgaaggcggctcgctgaccggc
agcatctcgatgctgcgccggcccaccccgagcgtgcgtttcgagcgcggtcgcgccgcg
cattggcgattgatttcccatctggcgttgaatcatgtgtcgcttgccaatagcggcctg
tcggcgctcaaggaaatgctcgtgctctacgacttgcggcgaacggcggtgtccgcgcgg
catatcgacggactggtcggcatcgaacagcatgccgccgtgcaatggctgccgggtaaa
ccgttcgccactttcgtgcgcggtatcgagattcgtttgacgatcgacgaagaacatttc
gtcggcacgagtctcgcgtcgttcgtgcgcgtgatcgatacgttttttgggctgtacgtg
catttgaacagctttgtgcaactggtcgtcgtgtcgaagcgcactggcgaggagatcctg
cgatgcaaaccgcgcagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system