KEGG   Paraburkholderia phytofirmans: Bphyt_5002Help
Entry
Bphyt_5002        CDS       T00765                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00860  Porphyrin and chlorophyll metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bphyt_5002
Enzymes [BR:bpy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Bphyt_5002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA_22 AAA AAA_3 AAA_16 AAA_30 Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: ACD19366
UniProt: B2TCE2
Position
2:1145510..1146586
Genome map
AA seq 358 aa AA seqDB search
MSTTMSANAARPVFPFAALIGQAPLQQALLLAAIDPGLGGVLVTGPRGTAKSTAARALAE
LLPEGQLVNLPLGASEDRLIGTLDLETVLRDGSVRFSPGLLAKAHRGVLYVDEVNLLPDA
LVDALLDAAASGVNTVERDGVSHSHDASFVLIGTMNPEEGELRPQLIDRFGLMIELQNCF
EPRVRQAIVKARLAFDLDPQGFRAGYAQQQAAYVERIRVARAALPQLAFDDAVHAHVSAL
CIDAAVDGLRADLVMLRAARALAALEQAAAVTAEHVDRVAEAVLAHRRHVRESPAEGGPR
EGDAERAASSDSRSSSAEGDGPPPAAAAAADSDWGYLAPEPAATTHVKGVIPLNVKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacgatgagtgccaacgccgcgcggcccgtttttccctttgccgcgctgatc
ggccaggcgccgttgcagcaggcgctgctgctggccgccatcgatccgggattgggcggc
gtgctggtcaccgggccgcgtggcaccgcgaagtcgaccgcggcgcgcgcgctggctgag
ttgttgccggaagggcaactggtgaatctgccgcttggcgcgagcgaagatcgcctgatc
ggtacgctcgatctcgaaaccgtgttgcgcgacgggtcggtgcgcttctcgcccggtctg
ctcgcgaaggcgcaccgcggcgtgctgtatgtggatgaagtcaatctgctgcccgacgcg
ctcgtcgatgccttgctcgacgccgccgcgagcggcgtgaataccgttgaacgcgatggc
gtatcgcacagccacgacgcgagcttcgtgctgatcggcacgatgaatcctgaagagggc
gaactgcggccgcaattgatcgaccgcttcggcttgatgatcgagttgcagaactgtttc
gagccgcgcgtgcgtcaggcgatcgtgaaggcgcggctcgcgttcgatctcgatccgcag
ggctttcgcgcgggctatgcgcagcagcaggccgcttatgtcgagcggattcgagtggcg
cgcgcagcgctgccgcaactcgcgttcgatgacgccgtgcatgcgcatgtgagcgcgctc
tgcatcgacgccgccgtggatggtttgcgcgccgatctcgtgatgctgcgcgcggcgcgc
gcgttggcggcgcttgaacaggcggctgcggtgacggcggagcatgtcgatcgggtggct
gaggcggtgttggctcatcggcggcatgttcgcgagtcgccggccgaaggtggcccgcgt
gagggcgacgccgaacgtgcggcttcttccgatagcaggtcctcatccgcggaaggcgat
gggccgccgccggccgccgctgccgccgccgattcggattggggctatctcgcgcccgag
ccggccgcaaccacgcacgtcaagggcgtcattccacttaatgtaaaaaaacgctga

DBGET integrated database retrieval system