KEGG   Paraburkholderia phytofirmans PsJN: Bphyt_5039
Entry
Bphyt_5039        CDS       T00765                                 

Name
(GenBank) protein of unknown function DUF125 transmembrane
  KO
K22736  vacuolar iron transporter family protein
Organism
bpy  Paraburkholderia phytofirmans PsJN
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpy02000]
    Bphyt_5039
Transporters [BR:bpy02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Bphyt_5039
SSDB
Motif
Pfam: VIT1 Rubrerythrin
Other DBs
NCBI-ProteinID: ACD19403
UniProt: B2TCH9
Position
2:1192558..1193688
AA seq 376 aa
MASRREVERYKANLSDELHSAALYETLAKVEQDGARKQVYSELARSERDHAQVWADKLRA
NGLDPKGTGQAVKTRLMKGLVRLFGAGFVLPTLAAAEYADRNKYQGQPDAGRMSADEHHH
AAMVQALAHGGGDASLAPGARIAAAESWHKGAGSGNDLRAAVLGANDGLVSNFCLIMGVA
GAGTGNKAILLTGLAGLIAGACSMALGEWLSVTNARELASTQVAKEAQELEESPEAEEHE
LALIYRAKGLDAGEAKRVASQMMRDKSKALDTLTREELGLDPAELGGNPWSAAGVSFCLF
SVGAIFPVMPFLWTHGYSAIMQCVVLSMLALASIGVFTSLFNGRSAGFSALRQVVIGLIA
AAFTFGVGRLLGVSVS
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcatccagacgcgaagtagaacgatacaaagccaatctctccgatgaactgcacagc
gccgcgctgtacgaaacgctcgcgaaggtcgagcaagacggcgctcgcaagcaggtctac
agcgagcttgccagatccgagcgcgatcatgcgcaagtctgggccgacaagctgagagcc
aacggccttgatccgaaaggcaccggtcaggccgtcaaaacgcgtttgatgaaaggactg
gtccgcctgttcggtgcgggcttcgtgctgcccacgctggcggccgcggagtacgccgat
cgcaacaaataccaggggcagccggacgcgggccgcatgtcggccgacgaacatcatcac
gccgcgatggtgcaggcgctggctcatggcggcggcgacgcgagcctcgcgccgggcgcg
cggatcgccgcggctgaatcgtggcacaagggcgcggggtcgggcaacgacttgcgcgcc
gccgtgctcggcgccaacgacggcctcgtctcgaacttctgcctgatcatgggcgtggcc
ggcgcgggcaccggcaacaaggcgattctgttgacggggctggcgggactcatcgccggc
gcgtgttcgatggcgctgggcgaatggctctcggtgaccaatgcgcgcgagctggccagc
acgcaggtcgcgaaagaggcgcaggaactcgaagaatcgccggaagccgaagaacacgaa
cttgcgctgatctatcgcgccaagggtctcgacgcgggcgaggccaaacgggtcgcctcg
caaatgatgcgcgacaaaagcaaggcgctcgacacgctcactcgcgaagaactcggactc
gatccggcggagttgggcggcaatccatggtccgcggcgggcgtgtcgttctgcctgttc
tccgtgggcgcgatttttccggtaatgccgtttctgtggacgcatgggtatagcgcgatc
atgcaatgcgtggtgctcagcatgctggcgctcgcttcgatcggtgtgttcacgtcgctt
ttcaacggacgcagcgcggggttttccgcgttgcggcaggtcgtgatcggactgatcgcg
gctgcgttcacgttcggggtggggcggttgctgggcgtgtcggtgtcgtga

DBGET integrated database retrieval system