KEGG   Paraburkholderia phytofirmans: Bphyt_5918Help
Entry
Bphyt_5918        CDS       T00765                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00010  Glycolysis / Gluconeogenesis
bpy00020  Citrate cycle (TCA cycle)
bpy00620  Pyruvate metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
bpy01200  Carbon metabolism
Module
bpy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphyt_5918
   00020 Citrate cycle (TCA cycle)
    Bphyt_5918
   00620 Pyruvate metabolism
    Bphyt_5918
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bphyt_5918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Thioesterase Ndr Esterase PGAP1 Abhydrolase_8 LIDHydrolase DUF915 Ser_hydrolase DUF900 DUF676 Esterase_phd
Motif
Other DBs
NCBI-ProteinID: ACD20253
UniProt: B2TG00
Position
2:complement(2139032..2140144)
Genome map
AA seq 370 aa AA seqDB search
MPIHMITMPKWGLSMEQGQVNGWLKAIGDKVVKGDEILDVETDKISSGVECAFEGILRRQ
IAQEGDTLPIGALLAVVADAETPDAQIDAEVEAFQRDFVPATSADGDSGPQPEKAQIGGR
TVRYLKLGEGGTPALLIHGFGGDLNNWLFNHADLAAHRAVWALDLPGHGESGKALETGSA
DELADSVIAFMDDRGIDKVQLIGHSMGALIAMTVAAKAPGRVASLALISSAGLGKEINGD
YIHGFTEGSNRNALKPQLAKLFADPGLVTRQLVEDIVKYKRLEGVPEALRKISASAFDGN
AQRASYRDRLAELAPRALVIWGAGDQIIPAAHAQGLPGDIRVHVLEGKGHMVQMEAASEV
NRLLDDFLGR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccatatgatcacgatgcccaaatggggcttgtcgatggagcagggacaagtc
aatgggtggcttaaggccatcggcgacaaggtagtgaagggcgacgagattctggacgtg
gaaacggacaagatctcgtcaggcgtcgaatgtgcgttcgagggcatcttgcgccggcag
atcgcgcaggagggcgacacgctgccgatcggcgcgttgctggccgtagtcgccgacgcg
gaaacgccggacgcgcagatcgacgccgaggtcgaagcatttcagcgcgacttcgtgccg
gccacgtcggcggatggcgacagtgggccgcaaccggagaaagcgcagatcggcgggcgc
acggtgcgttatctgaaactcggcgaaggcggcacgcccgcactgctgattcacggcttc
ggcggcgatctgaacaactggctgttcaatcacgccgacctcgccgcgcatcgggccgtg
tgggcgctggatctgccgggtcacggcgaatccggcaaggcgctcgagacgggcagcgcc
gacgaactcgcggacagcgtgatcgccttcatggacgatcgcggcatcgacaaggtgcag
ttgatcgggcactccatgggcgcgctgatcgcgatgaccgtcgccgcgaaagcgccgggg
cgcgtggcgtcgctcgcgttgatttcgagtgcgggtctgggcaaggagatcaacggcgac
tacatccacggttttactgaaggcagcaatcgcaatgcgctcaagccgcagttggcgaaa
ctcttcgccgacccgggtctcgtgacgcgtcaactggtggaggacatcgtcaagtacaag
cggctcgaaggcgtgcccgaggcgctgcgcaagatatcggcgtcggccttcgacggcaac
gcgcaacgggcgagctatcgggaccggctggcggaactcgcgccgcgcgcgctggtgatc
tggggcgccggcgatcagatcatcccggccgcgcatgcgcagggtctgccgggcgacatc
cgcgttcatgtgctcgaaggcaaggggcatatggtgcagatggaggctgcgtccgaagtg
aatcgtctgctcgacgattttctggggcgctga

DBGET integrated database retrieval system