KEGG   Paraburkholderia phytofirmans PsJN: Bphyt_7346
Entry
Bphyt_7346        CDS       T00765                                 
Name
(GenBank) hypothetical protein
Organism
bpy  Paraburkholderia phytofirmans PsJN
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACD21631
UniProt: B2TH82
Position
pBPHYT01:73817..74152
AA seq 111 aa
MEKDELTSSVVIRAGQRPALMLYVPLSLFIMEAMVGLVLFRLIGYWVAMLIPIHFYFVTR
TAEDYHWMTTVKADIYHYFFFVKNKGLHGKGVITFTASPPNARQRNYDGLR
NT seq 336 nt   +upstreamnt  +downstreamnt
atggaaaaagacgagctgacttccagcgtcgtcatccgggccgggcaacgtccggccctg
atgctctacgtacccctgtcgcttttcatcatggaggcaatggtcggtctcgtgctgttt
cgcctgattggttattgggttgccatgctgattccaattcacttctatttcgtgacgcgg
acagccgaggactaccactggatgaccacggtgaaagccgacatctaccactacttcttc
ttcgtcaagaacaaggggcttcacggcaaaggggttatcaccttcacggcatcgccgccc
aatgcacgtcagaggaactatgacggtctacgatga

DBGET integrated database retrieval system