KEGG   Burkholderia pyrrocinia: ABD05_03325Help
Entry
ABD05_03325       CDS       T03962                                 

Definition
(GenBank) dimethylglycine dehydrogenase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ABD05_03325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpyr01002]
    ABD05_03325
Enzymes [BR:bpyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     ABD05_03325
Peptidases [BR:bpyr01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   ABD05_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: AKL99314
UniProt: A0A0G3WP69
Position
1:714220..714903
Genome map
AA seq 227 aa AA seqDB search
MTLHIGLLVFPGVQQLDLTGPHDVLALLPDATVHLVWKSRDTVASSSGLALAPTCTFDDC
PPLDVICIPGGIGINELLLDAETTAFVQQRAATARYVTSVCTGALLLGVAGLLRGRRATT
HWAFHALLEPLGAVPVHERVVRDGNLITGGGVTAGIDFALTIAAELAGNEEAQAIQLQLE
YAPAPPFDAGSPDTAPASVVKLATERSAASFAKRKQAIEQALRAMSH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcatatcggccttctcgtgtttcccggcgtccagcaactcgatctcaccggc
ccgcacgacgtgctcgcgttgctgcccgacgcgaccgtccatctggtctggaagtcgcgc
gacaccgtcgcgtcgagcagcggccttgcgctcgcgccgacctgcacgttcgacgactgc
ccgccgctcgacgtgatctgcattccgggcggcatcgggatcaacgaactgctgctcgat
gccgaaacgaccgcgttcgtgcagcagcgcgcggccactgcccgctacgtgacgtcggtc
tgcacgggcgcgttgctgctcggcgtggccggcctgctgcgcgggcggcgcgcgacgacg
cactgggcgttccacgcgctgctcgaaccgctgggtgcggtgcccgtgcacgagcgcgtc
gtgcgcgacggcaacctgatcaccggtggcggcgtgacggccggcatcgacttcgcgctg
acgatcgccgcggaactggccggcaatgaagaagcgcaggcgatccagcttcagctcgaa
tacgcacccgcgccgccgttcgacgccggctcgcccgacaccgcaccggcatcggtcgtg
aagcttgccaccgaacgttcggcggccagcttcgcgaagcgcaagcaggcgatcgagcag
gcgctgcgcgcgatgtctcactga

DBGET integrated database retrieval system