KEGG   Burkholderia pyrrocinia: ABD05_03740Help
Entry
ABD05_03740       CDS       T03962                                 

Definition
(GenBank) amino acid deaminase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00260  Glycine, serine and threonine metabolism
bpyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABD05_03740
Enzymes [BR:bpyr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     ABD05_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: D-ser_dehydrat Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: AKM01682
UniProt: A0A0G3WSL9
Position
1:807946..809226
Genome map
AA seq 426 aa AA seqDB search
MKVTNYQEATIDPFGKGLGNLPSASVPLGDAGRLEWNLLAEDVSLPAAVLYEDRIEHNLN
WMQAFVQQYGVKFAPHGKTTMAPQLFRRQLDAGAWGITLATAHQTQAAYHGGVRRVLLAN
QLVGRQNMTIIAGLLSDPDFEFFCLVDSAESVDQLGRFFGDAKKSLNVLLELGVPGGRAG
VRDAAQREAVLAALARYPDTLKLAGIELYEGVLKEEGEIRTFLQGAVALTRELADAGRFA
RTPAILSGAGSAWYDVVAEEFAKASDAGFAEVVLRPGCYLTHDVGIYKKAQTDVFARNPI
ARTMGEGLLPALQLWAYVQSVPEQNRAIVALGKRDAAFDAGLPEPARHFRPGRDTAPRDV
AATEGWAVTGMMDQHAYLQIPPGADVKVGDMVAFDISHPCLTFDKWRQVLVLDPQFRVTE
VVETFF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacaaactatcaggaagcgacgatcgatccttttggcaagggcctcggcaac
ctgccgagcgccagcgtgccgctcggcgacgcgggccggctcgagtggaacctgctcgcg
gaagacgtcagcctgccggctgccgtgctttacgaggaccgcatcgaacacaacctgaac
tggatgcaggcgttcgtccagcagtatggcgtcaagttcgcgccgcacggcaagacgacg
atggcgccgcaactgttccgccgccagctcgacgccggcgcatggggcatcacgctcgcg
accgcgcaccagacgcaggccgcgtatcacggcggcgtgcggcgcgtgctgctcgcgaac
cagctcgtcggccgccagaacatgacgatcatcgccgggctgctgtccgatcccgatttc
gaattcttctgtctcgtcgattccgccgagagcgtcgaccagctcggccgcttcttcggc
gacgcgaaaaaatcgctgaacgtgctgctcgagctcggcgtgccgggcggccgcgcgggt
gtgcgcgacgccgcgcagcgtgaggccgtgctcgccgcgctcgcgcgctatccggacacg
ctgaagctggccggcatcgaactctatgaaggcgtgctgaaggaggaaggcgagatccgc
acattcctgcaaggcgcggtcgcgctcacgcgcgagctggccgacgcgggccgcttcgcg
cgcacgccggcgatcctgtccggcgccggttcggcgtggtacgacgtggtcgcggaagaa
ttcgcgaaggcgtccgacgcgggcttcgcggaagtcgtgctgcgcccgggctgctacctg
acgcacgacgtcggcatctacaagaaggcgcagaccgacgtgttcgcgcgcaacccgatc
gcacgcacgatgggcgaagggctgctgcccgcgctgcagctgtgggcgtacgtgcagtcg
gtgccggagcaaaatcgcgcgatcgtcgcgctcggcaagcgcgacgcggcattcgacgcg
ggcctgcccgagccggcgcgccacttccgcccgggccgcgacaccgcgccgcgcgacgtc
gccgccaccgaaggctgggccgtgaccgggatgatggaccagcacgcgtacctgcagatc
ccgccgggcgccgacgtgaaggtcggcgacatggtcgcgttcgacatctcgcacccgtgc
ctgacgttcgacaagtggcgccaggtgctcgtgctcgatccgcagttccgcgtgacggaa
gtggtcgaaacgttcttctga

DBGET integrated database retrieval system