KEGG   Burkholderia pyrrocinia: ABD05_03765Help
Entry
ABD05_03765       CDS       T03962                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00903  Limonene and pinene degradation
bpyr00930  Caprolactam degradation
bpyr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABD05_03765
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ABD05_03765
Enzymes [BR:bpyr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     ABD05_03765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AKL99388
UniProt: A0A0G3WM44
Position
1:complement(813091..814053)
Genome map
AA seq 320 aa AA seqDB search
MSWQSKFACWLLRWQFRPETTREVLDPARARRFTDLRMVVPRRAPSGYRLRQCYGAGDAP
LRGEWLERTDAGAGRGPGRTLLYFHGGGYYFCSTRTHRPLVFGLTKRAGVRSFSLDYRLA
PENRFPAALDDALAAYWQLLALGTPPESIVLGGDSAGGGLALATLVALRDRGEPLPAGAI
LFSPWTDLAATGDTLRTNDGADPMFAGAALPKAAKLYLGDAPATHPYASPLYADFAGLPP
LYIQVGSTEVLLDDSRRVAEKAKAAGVPVEIEVWPDMPHVWQLYAPMVPEARDALDRAAA
FLRRVAVERAVQRVGEASIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcaagttcgcctgctggctgctgcgctggcagttccgtcccgagacc
acgcgcgaggtgctcgatccggcccgcgcacggcgctttaccgacctgcggatggtcgtg
ccgcgccgcgcgccgtcgggctaccggctgcgccagtgctacggcgcgggtgacgcgccg
ctgcgcggcgaatggctcgaacgcaccgacgcgggcgcgggtcgcgggccgggccgcacg
ctgctgtatttccacggcggcggctattacttctgttcgaccagaacccaccggccgctc
gtgttcggcctgacgaagcgcgcaggcgtgcgctcgttctcgctcgactaccggctcgca
ccggaaaaccgctttccggccgcgctcgacgatgcgctggccgcatactggcaactgctg
gcgctcggcacgccgcccgagtcgatcgtgctcggcggcgattcggcgggcggcggcctc
gcgctcgcgacgctcgtcgcgctgcgcgaccgcggcgagccgttgccggccggcgcgatc
ctgttctcgccgtggaccgatctcgcggccaccggcgacacgctgcgcacgaacgacggt
gccgatccgatgttcgccggcgcggcgttgccgaaggccgcgaagctgtacctcggcgac
gcgccggcgacgcatccgtacgcatcgccgctctatgcggatttcgcgggcctgccgccg
ctgtacatccaggtcggcagcaccgaggtgctgctcgacgattcgcgccgcgtcgcggag
aaggcgaaggcagccggcgtgccggtggagatcgaggtgtggccggacatgccccacgtg
tggcagctttacgcgccgatggtgcccgaggcgcgcgatgcgctcgaccgcgcggccgcg
ttcctgcgccgcgtcgcggtcgaacgtgcggttcagcgcgtcggcgaggcgtcgatcgcc
tga

DBGET integrated database retrieval system