KEGG   Burkholderia pyrrocinia: ABD05_08285Help
Entry
ABD05_08285       CDS       T03962                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00071  Fatty acid degradation
bpyr00072  Synthesis and degradation of ketone bodies
bpyr00280  Valine, leucine and isoleucine degradation
bpyr00310  Lysine degradation
bpyr00362  Benzoate degradation
bpyr00380  Tryptophan metabolism
bpyr00620  Pyruvate metabolism
bpyr00630  Glyoxylate and dicarboxylate metabolism
bpyr00640  Propanoate metabolism
bpyr00650  Butanoate metabolism
bpyr00900  Terpenoid backbone biosynthesis
bpyr01100  Metabolic pathways
bpyr01110  Biosynthesis of secondary metabolites
bpyr01120  Microbial metabolism in diverse environments
bpyr01130  Biosynthesis of antibiotics
bpyr01200  Carbon metabolism
bpyr01212  Fatty acid metabolism
bpyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABD05_08285
   00630 Glyoxylate and dicarboxylate metabolism
    ABD05_08285
   00640 Propanoate metabolism
    ABD05_08285
   00650 Butanoate metabolism
    ABD05_08285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABD05_08285
   00072 Synthesis and degradation of ketone bodies
    ABD05_08285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABD05_08285
   00310 Lysine degradation
    ABD05_08285
   00380 Tryptophan metabolism
    ABD05_08285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABD05_08285
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABD05_08285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABD05_08285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpyr04147]
    ABD05_08285
Enzymes [BR:bpyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABD05_08285
Exosome [BR:bpyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABD05_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AKM00197
UniProt: A0A0G3WND2
Position
1:complement(1787368..1788570)
Genome map
AA seq 400 aa AA seqDB search
MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALVERNRNVDWTAIDDVIYGCANQA
GEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTAARAIKSGEARLMVAGGVETM
TRAPFVMGKAASAFARQADIFDTTIGWRFVNPLMKQLHGVDSMPETAENVAVDYNISRAD
QDLFALRSQQKAARAQQDGTLAEEIVSVTIPQKKGDPVVVSRDEHPRETSLEALAKLKGV
VRPDGSVTAGNASGVNDGACALLLANAQAADQYGLRRRARVVGMATAGVEPRVMGIGPAP
ATQKLLRQLGMTIDQFDVIELNEAFAAQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTALHQLERTGGRFALCTMCIGVGQGIALAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcctacatctgcgacgcgattcgcacccccatcggccgctacggcggcgcc
ctgaaggatgtccgtgccgacgatctcggcgcagtgccgctcaaggcgctcgtcgagcgc
aaccgcaacgtcgactggacggcgatcgacgacgtgatctacggctgcgcgaaccaggcc
ggcgaagacaaccgcaacgtcgcgcgcatgtcggcgctgctcgcgggccttccgaccgcc
gtgccgggcacgacgctgaaccggctgtgcggctccgggatggacgcggtcggcacggcc
gcgcgcgcgatcaagtcgggcgaagcgcgcctgatggtcgcgggcggcgtcgagaccatg
acgcgcgcgccgttcgtgatgggcaaggccgcgagcgcgttcgcacgccaggccgacatc
ttcgacacgacgatcggctggcgcttcgtcaatccgctgatgaaacagcttcacggcgtc
gattcgatgccggagacggccgagaacgtcgcggtcgactacaacatcagccgcgccgac
caggacctgttcgcgctgcgcagccagcagaaagccgcgcgcgcgcagcaggacggcacg
ctcgccgaggaaatcgtgtcggtcacgattccgcagaagaagggcgatccggtcgtggta
tcgcgcgacgaacatccgcgcgagacgtcgctcgaagcgctcgcgaagctgaagggcgtc
gtgcgcccggatggttcggtgacggccggcaacgcatcgggcgtcaacgatggcgcgtgc
gcgctgctgctcgccaatgcgcaggcagccgaccagtacggcctgcgccgccgtgcgcgc
gtcgtcggcatggcgacggccggcgtcgagccgcgcgtaatgggcatcggccccgcgccg
gccacacagaaactgctgcgccagctcggcatgacgatcgaccagttcgacgtgatcgaa
ctgaacgaggcgtttgcggcgcagggtctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccgcgcgtgaacccgaacggcggtgcgatcgcactcggccacccgctcggcgca
tcgggtgcccggctcgtgaccacggcgctccatcaactcgagcgtacgggcggccgcttt
gcgctctgtacgatgtgcatcggcgtcggccagggcatcgcactcgcgatcgaacgcgtg
taa

DBGET integrated database retrieval system