KEGG   Burkholderia pyrrocinia: ABD05_09275Help
Entry
ABD05_09275       CDS       T03962                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpyr  Burkholderia pyrrocinia
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABD05_09275
Enzymes [BR:bpyr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ABD05_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKM00377
UniProt: A0A0G3WNT9
Position
1:complement(2007284..2008111)
Genome map
AA seq 275 aa AA seqDB search
MTDHTRSATPYRVAALQMVSTPDVARNLAEARRLIAEAAGEGAQLVLLPEYFCFMGHRDT
DKLALAEPYQDGPIQHFLADAARRHGIWVIGGTLPLKAPEPDRVLNTTLVFDPSGNEAAR
YDKIHLFNFEKGDESFDEARTIRAGDTVVAFDAPFGRVGLSVCYDLRFPELYRRLGDCTL
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIV
AVRDVGASVVLGAIDPQRIADVRQSLPAWRHRVLT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacacccgttccgccacgccctaccgggtcgccgcgctgcagatggtgagc
acgccggacgtcgcgcgcaatctcgccgaagcccgccgcctgatcgcggaagcggccggc
gaaggcgcgcagctcgtgctgctgcccgagtatttctgcttcatgggccaccgcgatacc
gacaagctcgcgctcgccgaaccctaccaggacggtccgatccagcacttcctcgcggac
gccgcgcgccgccacgggatctgggtgatcggcggcacgctgccgctgaaagcgccggag
cccgatcgcgtgctgaacacgacgctcgtgttcgatccgtccggcaacgaggccgcgcgc
tacgacaagatccacctgttcaacttcgagaaaggcgacgagtcgttcgacgaggcgcgc
accatccgcgcgggcgatacggtcgtcgcgttcgacgcgccgttcgggcgggtcggcctg
tcggtctgttacgatctgcgctttcccgagctgtatcgcaggctgggcgactgcacgctg
atcgtcgtaccgtcggcgtttacgtatacgacgggccgcgcgcactgggaaacgctgctg
cgcgcgcgggccgtcgagaaccagtgctacgtgctcgcggccgcgcagggcggcaagcac
gagaacggccggcgcacctggggccacagcatgctgatcgacccgtggggcgagatcgtc
gcggtccgcgacgtgggcgcaagcgtcgtgctcggcgcaatcgatccgcagcgcatcgcc
gacgtgcgccagagcctgcccgcgtggcggcaccgcgtgctgacctga

DBGET integrated database retrieval system