KEGG   Burkholderia pyrrocinia: ABD05_10395Help
Entry
ABD05_10395       CDS       T03962                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00030  Pentose phosphate pathway
bpyr00480  Glutathione metabolism
bpyr01100  Metabolic pathways
bpyr01110  Biosynthesis of secondary metabolites
bpyr01120  Microbial metabolism in diverse environments
bpyr01130  Biosynthesis of antibiotics
bpyr01200  Carbon metabolism
Module
bpyr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bpyr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bpyr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABD05_10395
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABD05_10395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpyr04147]
    ABD05_10395
Enzymes [BR:bpyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ABD05_10395
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ABD05_10395
Exosome [BR:bpyr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ABD05_10395
  Exosomal proteins of colorectal cancer cells
   ABD05_10395
  Exosomal proteins of bladder cancer cells
   ABD05_10395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKM00580
UniProt: A0A0G3WSY1
Position
1:complement(2261335..2262804)
Genome map
AA seq 489 aa AA seqDB search
MHTDSSFTFVLFGGTGDLSMRKILPALFEAHRANMLAESGRIVAVARHESDQAGYLEWVD
THVKPHAVKAAGKAFDETAWKSFLQRIEYVKLDLGRAEDYAVLRDAIASLPGIRVFYLAT
GPSLFVPICNALASVGLSEGSRIVLEKPLGYDLRSSNAINDAVGEIFAEGQIYRIDHYLG
KEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYDNTGALRDMVQNHL
LQLLSIVAMEPPHSMDSDSVRDEKLRVLRALKPVDPRDIGKVAVRGQYHAGVIKGAQVPA
YATEPGVKPDSQTETFVALKVEIENWRWAGVPFFLRTGKRLADRVAEIVVNFRPVPHSAL
GPTALRPGSNRLVIRLQPNETIRLYCLAKQPGEGMNLASVHLDLAFDRFFKEGQMEAYQR
LLLDVINGRLALFVRRDEQEAAWRWVEPILNEWARSLKPPKPYAAGTWGPAAASAMLAQH
DTCWLEEEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgattccagctttaccttcgtacttttcggcggcaccggcgatctgtcgatg
cgcaagatcctgcctgcgctgttcgaagcgcaccgtgcgaacatgctggcggagagcggc
cggatcgtcgcggtggcgcggcacgaatcggatcaggcgggttatctcgagtgggtcgac
acgcatgtgaagccgcatgcggtcaaggcagccggcaaggcgttcgacgaaaccgcgtgg
aagtcctttctccagcgcatcgaatacgtgaagctcgacctcggtcgcgcggaagactac
gccgtgctgcgcgacgcgatcgcatcgctgcccggcatccgcgtgttctatctcgcgacg
ggcccgtcgctgttcgtgccgatctgcaacgcgctcgcgtcggtcggcctgagcgaaggc
tcgcgcatcgtgctcgagaagccgctcggctacgacctgcgctcgtcgaatgcgatcaac
gacgcggtcggcgagatcttcgcggaaggccagatctaccggatcgaccactacctcggc
aaggagccggtgcagaacctgctcgcgctgcgcttcggcaatgcgctgttcgagccgctg
tggcgccgcgaatgggtcgagagcatccagatcacgatcgccgaggagctcggcgtcgaa
gcgcgcggcgatttctacgacaatacgggcgcgctgcgcgacatggtgcagaaccacctg
ctgcaactgttgtcgatcgtcgcgatggagccgccgcattcgatggattccgactcggtg
cgcgacgaaaagctgcgcgtgctgcgggcgctgaaaccggtcgatccgcgcgacatcggc
aaggttgccgtgcgcggccagtatcatgcgggcgtgatcaagggcgcgcaggtgccggcc
tacgcgaccgagccgggcgtgaagcccgacagccagaccgaaaccttcgtcgcgctgaag
gtcgagatcgagaactggcgctgggccggcgtgccgttcttcctgcgcaccggcaagcgt
ctcgccgaccgcgtcgcggagatcgtcgtcaacttccgcccggtgccgcattcggcgctc
ggaccgaccgcgctgcgtcccggttcgaaccgcctcgtgatccggctgcagccgaacgag
acgatccgcctgtactgcctcgcgaagcagcccggcgaagggatgaacctcgcgagcgtg
cacctcgacctcgcgttcgaccggttcttcaaggaagggcagatggaggcgtaccagcgc
ctgctgctcgacgtgatcaacggccggctcgcgctgttcgtgcgtcgcgacgaacaggaa
gccgcatggcgctgggtcgagccgatcctgaacgaatgggcgcgctcgctgaagccgccg
aagccgtacgcggcgggcacgtgggggccggccgcggcgagcgcgatgctcgcgcagcac
gacacctgctggctcgaagaagaaaactga

DBGET integrated database retrieval system