KEGG   Burkholderia pyrrocinia: ABD05_14945Help
Entry
ABD05_14945       CDS       T03962                                 

Gene name
entE
Definition
(GenBank) enterobactin synthase subunit E
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr01053  Biosynthesis of siderophore group nonribosomal peptides
bpyr01110  Biosynthesis of secondary metabolites
bpyr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    ABD05_14945 (entE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bpyr01008]
    ABD05_14945 (entE)
Enzymes [BR:bpyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     ABD05_14945 (entE)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     ABD05_14945 (entE)
Polyketide biosynthesis proteins [BR:bpyr01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    ABD05_14945 (entE)
   Bacillibactin synthetase
    ABD05_14945 (entE)
  Nonlinear NRPS
   Vibriobactin synthetase
    ABD05_14945 (entE)
   Myxochelin synthetase
    ABD05_14945 (entE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AKM01374
UniProt: A0A0G3WSS4
Position
1:complement(3280202..3281818)
Genome map
AA seq 538 aa AA seqDB search
MTSANRTPWPDAFAAAYRQKGYWLGQSFAQWFDERVARHGERVALVQGDLRWSYRTFAAE
AERTARALTACGIVPGERVVVQLPNCVAFFAVTFALFRIGALPVFALPAHRRREIGYFCR
YAGAVAYVAAEQHDGFDYRALASEIRTDAPTLRHVLFTTPGNTRVALPDATPDVALPPGP
GAHEIAFLQLSGGSTGTPKLIPRTHDDYLYSVRESARICGLTERSVYLAALPAAHNYALS
SPGSLGVFDAGGTVVLSDGASPDAAFPLIERERVTVAALVPPLVPVWLAAAGQRRGALAS
LELVQVGGARFDPALAARAADGFGTQLQQVFGMAEGLVNYTRLDDPRDVVIATQGRPISP
DDEIRIVDDDDRPVAPGEVGHLLTRGPYTIRGYYDAAAHNARAFTADGFYRTGDRVRLTA
GGQLVVEGRAKDQINRGGEKIPAEEIEHLLLAHPGVVDAALVAMPDPYLGERSCAYVIRG
APAPAAADLVRFVRGQGVAAYKVPDRIEFVDAFPKTPVGKIDKRALRQHIADRLAAAA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgcgaaccgcacgccgtggccggacgcgttcgccgccgcgtatcggcagaag
ggatactggctcggccagtcgttcgcgcagtggttcgacgaacgcgtcgcgcggcacggc
gaacgcgtcgcgctcgtacagggcgacctgcgctggtcgtaccggacgttcgcggcggaa
gccgaacgcacggcccgcgcgctgaccgcgtgcgggatcgtgccgggcgagcgcgtcgtc
gtgcaattgccgaactgcgtcgccttcttcgcggtgacgtttgcgctgttccggatcggc
gcgctgccggtgttcgcgctgcccgcgcatcgccggcgcgagatcggctacttctgccgg
tacgcgggcgcggtcgcctatgtcgcggccgaacagcacgacgggttcgactaccgggcg
ctcgcgagcgagatccgcaccgatgcgccgacgctgcgccatgtgctgttcacgacgccc
ggcaatacgcgcgtggcgctgccggatgcgacgcccgacgtcgcgctgccgccggggccc
ggcgcgcacgagatcgcgttcctgcaactgtcgggcggcagcacgggtacgccgaagctg
atcccgcgcacgcacgacgactacctgtacagcgtgcgcgagagcgcgcgcatttgcggg
ctgaccgaacgcagcgtctatctcgcggcgctgccggccgcgcacaactatgcgctgagt
tcgccgggctcgctcggtgtcttcgatgccggcggcaccgtcgtgctgagcgacggcgcg
agccctgacgccgcgttcccgctgatcgagcgcgagcgcgtgacggtggcggcactggtg
ccgccgctcgtgcccgtatggctggccgcggccgggcagcggcgcggcgcgctggcgagc
ctcgaactcgtacaggtcggcggcgcgcgcttcgatccggcgcttgcggcgcgcgcggcc
gacggcttcggcacgcaattgcagcaggtgttcgggatggccgaagggctcgtcaactac
acgaggctcgacgatccgcgcgacgtggtgatcgccacgcaagggcgcccgatctcgccg
gacgacgagatccgcatcgtcgacgacgacgaccgcccggtcgcacccggcgaggtcggc
catctgctgacgcgcggcccgtacacgatccgcggctactacgacgcggccgcgcacaac
gcgcgcgcgttcacggcggacggcttctatcgcaccggcgatcgcgtccgcctgacggcg
ggcggccagctcgtcgtcgaggggcgcgcgaaggaccagatcaaccgcggcggcgagaag
atcccggccgaggaaatcgaacacctgctgctcgcgcatccgggcgtcgtcgacgcggcg
ctggtcgcgatgcccgacccgtatctcggcgaacgcagttgcgcgtacgtgattcgcggc
gcgcccgcgccggccgcggcggacctcgtgcgcttcgtgcgtggccagggcgtggccgct
tacaaggtgcccgaccggatcgaattcgtcgacgcattcccgaaaacgcccgtcggcaag
atcgacaagcgcgcgcttcggcagcacatcgcggatcggctcgccgccgctgcgtga

DBGET integrated database retrieval system