KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0065Help
Entry
BP1026B_I0065     CDS       T02049                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00071  Fatty acid degradation
bpz00280  Valine, leucine and isoleucine degradation
bpz00281  Geraniol degradation
bpz00310  Lysine degradation
bpz00362  Benzoate degradation
bpz00380  Tryptophan metabolism
bpz00410  beta-Alanine metabolism
bpz00640  Propanoate metabolism
bpz00650  Butanoate metabolism
bpz00903  Limonene and pinene degradation
bpz00930  Caprolactam degradation
bpz01040  Biosynthesis of unsaturated fatty acids
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
bpz01212  Fatty acid metabolism
Module
bpz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BP1026B_I0065
   00650 Butanoate metabolism
    BP1026B_I0065
  Lipid metabolism
   00071 Fatty acid degradation
    BP1026B_I0065
   01040 Biosynthesis of unsaturated fatty acids
    BP1026B_I0065
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP1026B_I0065
   00310 Lysine degradation
    BP1026B_I0065
   00380 Tryptophan metabolism
    BP1026B_I0065
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP1026B_I0065
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BP1026B_I0065
   00281 Geraniol degradation
    BP1026B_I0065
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP1026B_I0065
   00930 Caprolactam degradation
    BP1026B_I0065
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BP1026B_I0065
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BP1026B_I0065
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BP1026B_I0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_8 DAO NAD_binding_2 AlaDh_PNT_C F420_oxidored UDPG_MGDP_dh_N Pyr_redox_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AFI64742
UniProt: A0A0H3HFL4
Position
1:70330..72453
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDAAVKGMLVTSAKPDFI
AGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPEAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLIDTGEEAAARGKDYSRKLVDK
QVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVFEDRAIKADVTRRSEAVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITRQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPASGGKKALW
PGLAQEFPLAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWDFPAFR
GGPASYIHGVGVDAFVATCDRLAARHGARFAAPALLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcgaccttgagctggaacctgccggcg
cgcagccagaacgtgctgaacggcgagagctgcgaggcgttcttcgcggcggcggcgcgc
gcgttgcaggatgcggcggtgaagggaatgctcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacagcgccgagacgctcttcgcgcgc
acgtgcgagctgcatcgcgcgctgcgcgcgctcgagacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggtgggctggagatcgcgctcgcgggccactatcgt
gtcgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgtctcgtcggcgtccaggcgtcgctgccg
ctgttgctcgaaggcaagcggctgaaggcggccgacgcgctggccgcgggcatcctgcat
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggctgctcgacgcgagc
cgtcgcaccgcgacgcagccgtgggacgcgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcggcagaagacg
tatggcaactacccggccgtcgcgagcatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcttgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
gaagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaaggtcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gataccggcgaagaggcggccgcgcgcggcaaggactattcgcgcaagctcgtcgacaag
caggtgcagcgcggccggctcgcgcgggaaaaggccgatgcattgctcgcgaagatcgtg
ccgacgaccgatttcgcgcggctcgacggcgcgcagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgccggagcgaagcggtgctcgcgcccgacgcg
cttttcgcgtcgaacacgtcgacgctgccgatcacggggctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgccggtggacaagatgccgctcgtcgag
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggcatgacgccgatcgtggtcaacgattcgcggggcttctacacgagccgcgtg
ttttcgacgtacgtgctcgaagggctcgcgatgctcgccgagggcgtcgcgcccgcgctg
atcgagaacgccggattgctcgccggcatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagctgatccacaagatcaccaggcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgaactcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgagcggcggcaagaaggcgctgtgg
ccggggctcgcgcaggagtttccgctcgcggccgagcagcccgacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgatgcggacgtcggcgcgattctcggctgggatttcccggcgttccgc
ggcgggccggcgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggcacggcgcgcgtttcgccgcgccggcgttgctgcgcgagatggcg
gcgcaggggcgaagcttctattga

DBGET integrated database retrieval system