KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1308Help
Entry
BP1026B_I1308     CDS       T02049                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BP1026B_I1308 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpz02022]
    BP1026B_I1308 (ompR)
Two-component system [BR:bpz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BP1026B_I1308 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AFI65950
UniProt: A0A0H3HM01
Position
1:complement(1412099..1412824)
Genome map
AA seq 241 aa AA seqDB search
METKNPSKILVVDDDPRLRDLLRRYLGEQGFNVYVAENATAMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGSNDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSETTEVFEFGEFSLNLATRTLTKSGQEIPLTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPGSPRFIQTVWGLGYVFIPDGA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaacccctccaagattctcgtcgtcgacgacgacccgcgcctgcgcgat
ctgctgcgccgctatctcggcgagcagggcttcaacgtgtatgtcgcggagaacgcgacg
gcaatgaacaagctctgggtgcgcgagcgtttcgacctgctcgtgctcgacctgatgctg
ccgggcgaggacggcctgtcgatctgccggcgcctgcgcggcagcaacgatcgcacgccg
atcatcatgctcaccgcgaagggcgaagacgtcgaccgcatcgtcggtctcgaaatgggt
gccgacgactacctgccgaagccgttcaacccgcgcgagctcgtcgcgcgcattcacgcg
gtgttgcgccgccaggcgcccgccgagctgccgggcgcgccctccgagaccaccgaggtg
ttcgagttcggcgagttctcgctgaacctcgcgacgcgcacgctcacgaaatccggccag
gagattccgctcacgacgggcgagttctcggtgctgaaagtgttcgcgcgccatccgcgc
cagccgctgtcgcgcgagaagctgatggagctcgcgcgcggccgggaatacgaagtgttc
gaccgcagcctcgatgtgcagatctcgcgcctgcgcaagctgatcgaacccgatccgggc
agcccgcgcttcatccagacggtgtggggcctcggctacgtgttcatccccgacggcgcg
gcctga

DBGET integrated database retrieval system