KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1487Help
Entry
BP1026B_I1487     CDS       T02049                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00010  Glycolysis / Gluconeogenesis
bpz00053  Ascorbate and aldarate metabolism
bpz00071  Fatty acid degradation
bpz00280  Valine, leucine and isoleucine degradation
bpz00310  Lysine degradation
bpz00330  Arginine and proline metabolism
bpz00340  Histidine metabolism
bpz00380  Tryptophan metabolism
bpz00410  beta-Alanine metabolism
bpz00561  Glycerolipid metabolism
bpz00620  Pyruvate metabolism
bpz00625  Chloroalkane and chloroalkene degradation
bpz00903  Limonene and pinene degradation
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_I1487
   00053 Ascorbate and aldarate metabolism
    BP1026B_I1487
   00620 Pyruvate metabolism
    BP1026B_I1487
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BP1026B_I1487
   00561 Glycerolipid metabolism
    BP1026B_I1487
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP1026B_I1487
   00310 Lysine degradation
    BP1026B_I1487
   00330 Arginine and proline metabolism
    BP1026B_I1487
   00340 Histidine metabolism
    BP1026B_I1487
   00380 Tryptophan metabolism
    BP1026B_I1487
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP1026B_I1487
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BP1026B_I1487
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BP1026B_I1487
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BP1026B_I1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFI66123
UniProt: A0A0H3HPQ6
Position
1:1605281..1606717
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgctcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaggcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system