KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2524
Entry
BP1026B_I2524     CDS       T02049                                 

Gene name
hemC
Definition
(GenBank) porphobilinogen deaminase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00860  Porphyrin and chlorophyll metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01240  Biosynthesis of cofactors
Module
bpz_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BP1026B_I2524 (hemC)
Enzymes [BR:bpz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     BP1026B_I2524 (hemC)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC
Other DBs
NCBI-ProteinID: AFI67120
UniProt: A0A0H3HQE5
Position
1:complement(2806584..2807573)
AA seq 329 aa
MNSETLPAELPATLTIASRESRLAMWQAEHVRDALRKLYPACDVKILGMTTRGDQILDRT
LSKVGGKGLFVKELESALADGRADLAVHSLKDVPMALPEGFALAAVMSREDPRDAFVSND
YASLDALPAGAVVGTSSLRREAMLRARHPRLDVRPLRGNLDTRLAKLDRGDYAAIILAAA
GLKRLGLAARIRALLDVDDSLPAAGQGALGIEIAARRADVAAWLAPLHDHASALAVEAER
AVSRALGGSCEVPLAAHAVWRGGELHLTGSVSTTDGARVLAAHAHARAATAADALALGRR
VSDALERQGARAIVDALVAASAQAQKGGA
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaactccgagactcttccggccgagctgcccgcgacgctgacgatcgcgtcgcgcgag
agccgcctcgccatgtggcaagccgagcatgtgcgtgatgcgctgcgcaaattatatcca
gcttgtgacgtgaaaatcctcgggatgacgacgcgcggcgatcaaattctcgatcgcacg
ctatcgaaggtcggcggcaagggcctgttcgtcaaggagctcgagagcgcgctcgccgac
ggccgcgcggatctcgccgtgcattcgctgaaggacgtgccgatggcgctgcccgaaggc
ttcgcgctcgcggcggtgatgagccgcgaggatccgcgcgacgcgttcgtgtcgaacgat
tacgcgtcgctcgacgcgctgccggcgggcgccgtcgtcggcacgtcgagcctgcgccgc
gaggcgatgctgcgcgcgcgccatccgcggctcgacgtgcggccgctgcgcggcaatctc
gacacgcggctcgcgaagctcgaccgcggcgattacgcggcgatcatcctcgccgccgcg
ggcctcaagcgtctcggcctcgccgcgcggatccgcgcgctgctcgacgtcgacgacagc
ctgcccgccgcggggcagggcgcgctcggcatcgagatcgccgcgcgccgcgccgatgtc
gccgcgtggctcgcgccgctgcatgatcatgcgagcgcgctcgcggtcgaggccgaacgc
gcggtgtcgcgcgcgctcggcggcagttgcgaggtgccgctcgccgcgcacgcggtgtgg
cgcggcggcgagctgcatctgacgggcagcgtgtcgacgacggacggcgcgcgcgtgctc
gccgcgcatgcgcacgcacgcgcggcgacggccgccgatgcgctcgcgctcggccgcagg
gtgtccgacgcgctcgagcggcaaggcgcgcgcgcgatcgtcgacgcgctcgtcgcggcg
agcgcgcaagcgcaaaagggcggcgcgtga

DBGET integrated database retrieval system