KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3115Help
Entry
BP1026B_I3115     CDS       T02049                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00071  Fatty acid degradation
bpz00280  Valine, leucine and isoleucine degradation
bpz00281  Geraniol degradation
bpz00310  Lysine degradation
bpz00360  Phenylalanine metabolism
bpz00362  Benzoate degradation
bpz00380  Tryptophan metabolism
bpz00410  beta-Alanine metabolism
bpz00627  Aminobenzoate degradation
bpz00640  Propanoate metabolism
bpz00650  Butanoate metabolism
bpz00903  Limonene and pinene degradation
bpz00930  Caprolactam degradation
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01212  Fatty acid metabolism
Module
bpz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BP1026B_I3115
   00650 Butanoate metabolism
    BP1026B_I3115
  Lipid metabolism
   00071 Fatty acid degradation
    BP1026B_I3115
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP1026B_I3115
   00310 Lysine degradation
    BP1026B_I3115
   00360 Phenylalanine metabolism
    BP1026B_I3115
   00380 Tryptophan metabolism
    BP1026B_I3115
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP1026B_I3115
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BP1026B_I3115
   00281 Geraniol degradation
    BP1026B_I3115
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP1026B_I3115
   00627 Aminobenzoate degradation
    BP1026B_I3115
   00930 Caprolactam degradation
    BP1026B_I3115
Enzymes [BR:bpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BP1026B_I3115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFI67698
UniProt: A0A0H3HTR6
Position
1:complement(3474966..3475793)
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADDHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctctatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgatcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcgatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system