KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3135Help
Entry
BP1026B_I3135     CDS       T02049                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00071  Fatty acid degradation
bpz00072  Synthesis and degradation of ketone bodies
bpz00280  Valine, leucine and isoleucine degradation
bpz00310  Lysine degradation
bpz00362  Benzoate degradation
bpz00380  Tryptophan metabolism
bpz00620  Pyruvate metabolism
bpz00630  Glyoxylate and dicarboxylate metabolism
bpz00640  Propanoate metabolism
bpz00650  Butanoate metabolism
bpz00900  Terpenoid backbone biosynthesis
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
bpz01212  Fatty acid metabolism
bpz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BP1026B_I3135
   00630 Glyoxylate and dicarboxylate metabolism
    BP1026B_I3135
   00640 Propanoate metabolism
    BP1026B_I3135
   00650 Butanoate metabolism
    BP1026B_I3135
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BP1026B_I3135
   00072 Synthesis and degradation of ketone bodies
    BP1026B_I3135
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP1026B_I3135
   00310 Lysine degradation
    BP1026B_I3135
   00380 Tryptophan metabolism
    BP1026B_I3135
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BP1026B_I3135
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP1026B_I3135
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BP1026B_I3135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpz04147]
    BP1026B_I3135
Enzymes [BR:bpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BP1026B_I3135
Exosome [BR:bpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP1026B_I3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFI67718
UniProt: A0A0H3HTT4
Position
1:3499166..3500359
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAVRTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggtgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcaccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcgcggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgatctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system