KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3438Help
Entry
BP1026B_I3438     CDS       T02049                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BP1026B_I3438 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpz03011]
    BP1026B_I3438 (rplV)
Ribosome [BR:bpz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BP1026B_I3438 (rplV)
  Bacteria
    BP1026B_I3438 (rplV)
  Archaea
    BP1026B_I3438 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AFI68017
UniProt: A0A0H3HQ32
Position
1:complement(3806715..3807044)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgacatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgtttcaccgcgcgcgcaaagggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system