KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0110
Entry
BP1026B_II0110    CDS       T02049                                 

Gene name
tssL-2b
Definition
(GenBank) type VI secretion system
  KO
K11892  type VI secretion system protein ImpK
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II0110 (tssL-2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0110 (tssL-2b)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0110 (tssL-2b)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFI68393
UniProt: A0A0H3HVU8
Position
2:122313..123614
AA seq 433 aa
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAA
ANPLLEAATPLLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVR
YCLCTALDEAANRTRWGGGGVWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILE
ILYRVLGLGFEGRYSVVADGRRHLEQIRQRLWTLITGARDAIQPELSLRWRGAEPGRLPL
LRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARILAIAKDEPAPPPQRLRLSILL
KNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREVARVGGRVTVT
GHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaattcgggcgcctttgacgaagccgcgttcgattttctcgtatcggacgaaggcgga
gcgaacgtcgcggccgatcgcgcgcgatcggccgcgaaggccgcgggcgcggagccggcg
cgcgatcggatcgacgcgtcggtcaacgtccagcatcgcctcgacgaagttcgcgcggcg
gccaatccgctgctcgaagccgcgacgcctttgctgcggatgctggcggacatgcctgcg
acgctagacacctccgaagccgtcgcgagccttcgcacgctgctcgtgcgagaggtcgcg
ctgttccagaacttgtgcgagaaggccgatttgccttggaagcacatggcggtcgtgcgt
tattgcctgtgcacggcactggacgaggcggccaatcgcacgcgctggggcggcggcggc
gtatgggcttcgcagagcttgctgattacatacgaaggcgaggtcgacggaggcgagaag
ttcttcctgttgatcggacgcatggcgacggatcctcaggagtacgtcgatattctcgag
attctctatcgcgtgctgggtctcgggttcgaagggcgctacagcgtcgttgcggacggc
cggcggcatctcgagcagattcgccagcgtttgtggacgctcatcaccggcgcgcgcgac
gcgattcagccggaattgtcgctgcgctggcgcggagcggagccgggcaggcttccgcta
ttgcgcagcgtgcccgcatgggcgagcggtgcgctcgtcttcctgctgttgttcggtctc
ttcgcgttctatcagtatcggttgctcaccgaacgcaatgcgctcgaggcgcgcatcctg
gcgatcgcgaaggacgagccggcgccgccaccgcagcgtttgcgcctgtcgatcctgctc
aagaacgaaattgcgcgcggtctactgacggtcgacgaagacgataggcgcagcgtggtc
gtgttccgtggcgattcgatgttccgctccggcgagagccgcgtgcttcccgagatcgag
ccggtgctcgacaaggtggcgcgggaagtggcccgcgtcggcggccgggtcacggtcacg
gggcactccgacaaccagccgattcggcgcgccgacatcccgaacaacctcgtgttgtcg
gaaaaacgcgcggcttacgtcgcgcaaatcctggtccagcgaggcactccggccgatcgt
attcgctcggagggccggggcgacgcgcagcccgtcgcggaaaacgcgacgcctgctggc
cgatcccgcaaccgccgcgtcgaaatcgcggtcacgctgtaa

DBGET integrated database retrieval system