KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0111Help
Entry
BP1026B_II0111    CDS       T02049                                 

Gene name
tssM-2
Definition
(GenBank) type VI secretion system
  KO
K11891  type VI secretion system protein ImpL
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP1026B_II0111 (tssM-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0111 (tssM-2)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0111 (tssM-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AFI68394
UniProt: A0A0H3HQ68
Position
2:123629..127537
Genome map
AA seq 1302 aa AA seqDB search
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVAL
LAFWLLRWPLSPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLY
RLWQAVRTNDALLKRILEPSAGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLL
ESGRYLYELPWYMVVGAPGAGKSAAIARSGLKFPLADQMEASSERARGGTANCEWWFANE
AVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHRPRAPVNGVVLSVSVEELVGR
TPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLTAEGRTQIWGF
TLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRM
LGGDAGAQTRDSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAV
ALLVWLASALTVSFDNNRGYLDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQH
GNLDLDAPGASFRYGLYVAPGIVDASDATYRSLLRRSLLPQIVRRVEDALSAQIDAKHAD
EVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEMGGRNLMARHLDALFVDARPF
EPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVGLQGAGIFRLA
DGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPL
VRLARAVVRETSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEK
ELVDNRFAALREVVTGQADTGSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNA
LSSQSMPPALDIGTTLQMEAEKLPAPLRTVLGGIATQAADKVGREVGSLLAMQVDSSVGN
ACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQKALAPHVDTHSKPWRYKALNP
GMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITELIVDVDGQSQR
YVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacctgaaacgcttcttgagattcgtcttttcgtggcagatgctcgcatgcatc
gcggtgctgcttgtttgcgccgccgtatggttcgtcggccccctgctcgcgttcgacgag
ttgcggccgctcgcgggcgtcgtcgtgcgggtcgccgtcatcgtccttctcgtggcgctc
cttgcgttctggctgttgcgctggccgctcagcccgatcggcgtcgccgcactgtgtctg
ctgatctggcacgcggggccgctcttcgcgttcggcgatcaccgcccgttcgggcccgcg
tgggtccgcgtgctgatcgtcgccgcgatgctcttctgctacgccgtgtatggtctctat
cgcctgtggcaggcggttcggacgaacgacgcattgctcaagcgcattctcgagccgtcg
gcgggcaagccggacgcggcggcccaggcgaacatccgtgcggtgagcgtggcggtgtcg
aaggcgatcggtcaactgaagcgcttgcgcggcggtgcgttcggctggcggcgcttgctc
gaaagcgggcgctacctgtatgaactgccgtggtacatggtggtcggcgcgcctggtgcg
ggcaagagcgcggcgatcgcgcgttccggcctgaagtttccgctcgcggatcagatggag
gcatcgtccgagcgcgcgcggggcggcacggccaattgcgaatggtggttcgccaacgag
gccgtgttgatcgacacggcgggccgttacgtgcggcacgaggtgcccggcgacgaagag
gcgacagttgccaacggggcggaatggaagggctttctcggtctgcttcgcaaacatcgg
ccgcgcgcgccggtcaatggcgtggtcctgtcggtcagcgtcgaggagctcgtcgggcgc
acgccggccgagcgcaccgcgcacgcagccacgctgcgcgcccgcctgggcgagttgcat
caggaactgggcattcatttcccggtatacgtgatcgtcacgaaactcgatttgctgccc
ggctttccggagtatttccagtcgttgacggccgaagggcggacgcagatctggggattc
acgctgccctacgacgcggagaacaggcggagcgcggtcggcgcgctgcgcgagcattgc
gccgacgagctgaagcggctggagatgcgtatcgacgcggggctgaacaaccgtctgctc
gaagagtacgaaaacgatcgccgcaagcggctgtatgcgttgccgcaggagttccggagc
ctgtcggccgcgctgtcggacatgctcgccctcgtgtttctcgattcacgctacgacgac
gcccagttgcagaacacgctgcgcggcgtctacttcacgagcgccgagcagacggatcag
gtattggccgcggatcgcgaaaccatcctgcagcgcctgaagcgccagctcggcagaatg
ctcggcggcgatgccggcgcgcagacgcgtgacagcggcgcggtgtcgggcagccgcggc
tacttcctgcgcgatgtgttccagcatgtgatcgtgccggaggcgcatctggttcggccg
aacgtcaggtgggaagtgcgttttcgcctgatgcgctgggccgggcatctgctcgccgtc
gcattgctggtctggctggcgagcgcgctgacggtgagcttcgacaacaatcgcggttac
ctggacgcgatctcggaaaagacagccgcgctcgccgcacgagtcaacgcgtacaacaag
gcgccgaagccggcgcagatcgggggcgtactggatggcgcgcgcgatcttcctcagcat
ggcaatctcgatctcgacgcgcccggcgcgagcttccgctacggcctgtatgtcgcaccc
ggcatcgtcgacgcgtccgacgcgacttatcggagcctgctgcgccggagccttctgccg
cagatcgtgcggcgcgtcgaagatgcactgagcgcgcaaatcgatgcgaagcatgcggac
gaggtctatcgcacgctgacggtctacttgatgctcgacgacgccgcgcgccatgacgcg
aaggcggtgaaagactgggtcatgcgcgactgggagcgctcggatagcgcggccgagatg
ggagggcgcaatttgatggcgcggcacctggacgcgctgttcgtcgatgctcggcctttc
gagccgagcgggcaccggaacgccgcactcgttcagcgcgcccgacttttcctcaacgcg
aatccggccccgaggcggctgtacgagcgtgcgatggccgcgatcgagaaggaggcgccg
gagaacttcacgctcgcgcgtgcggtcgggcttcagggcgcgggcatctttcggctcgcc
gacggctcgcggtttcaacgcgggatgcccggcttgtatacgtacgatggctaccaccag
gtattcagcgcccggttgcccgaatttctcgcccgtgcgcaaagcgacgacgcatgggtg
atggggaacgccggccccgccgcgcgatggggcgacgcgattcggaacacgcaggccgtt
gcgggtcggtcttcgcttgccgacgacattcgtcgccagtacctgacggattacggcaac
tattggcaacagtatctggcggacattcggcccgcgtcgtccggagaggacggcgcgggc
ggcacgctcgcattcgatctcgcgacgctgcgcgcgctcgccgcccccgattcaccgctc
gtgagactggcgcgcgccgtcgttcgcgaaacatcgctgtcggtcgtcgacgcacgggaa
gacgcgtcgttgaccgacgccgcgctttcgtcgctcgggcgacgatccggcgcggcgaag
gaggttgccgacggcgcgcagaaactggcggcgcggcggccggagcagcgcctcgagaag
gagctggtggacaaccgcttcgcggcgctgcgcgaggtggtgacggggcaggccgacacg
ggaagcgggccggcgatgacggacgtgccggtcgcggcggggggccgggcgctgcagctc
gacgcgatcctcacgctgatcaacgaacagtacacgcgcctcgtcgttgccgacaacgcg
ctctcctcgcagagcatgccgcccgcgctggacatcggcaccaccttgcaaatggaggcg
gagaaactgcccgcgccgctgcgcacggtgctgggcggcatcgcgacgcaagccgccgac
aaagtcgggcgcgaagtgggttcgctgctcgcgatgcaggtggactcgagtgtcggcaac
gcgtgtcgcgccgccgtcgacggcaagtatccgttcgcgcgcagcgcgcaggaagtcgac
atcgaggatttcaaccgcctcttcgccgcgggcggcctgttcgacgcgttttttcagaag
gcgctcgcgccgcatgtcgacacccattcgaagccgtggcgttacaaggcgttgaatccc
ggcatgccgccgatccgggggccgagcctcgagccgttcgagcgcgccgccgcgattcgc
gacgtgttctttcgtgaaccgggcgcaaagcggatggcgtggaggatggatgcgaaggtg
gcgtcgatcgaccctgagatcaccgagctcatcgtcgacgtcgacggccagtcgcagcgc
tatgtccacggccctgtgctgccgttctccgtgaactggcccgggccgcgcggcggcgcg
atcgccgagatcaccgcgaagccgcggattcgtcccgatacgtcgacgatcgcgacgacg
gggccctgggcgctgtttcggctgatcgagcgcgggcgattgacgggcaccacgtcggcg
agccggttgatgctggatttcgatttcgacggtcggcacgcggccctggagctcaggacg
aacggccagatgaatccgttgacgagcggcttgctgacgcattttcgctgtccggggagc
gtcggttga

DBGET integrated database retrieval system