KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0120
Entry
BP1026B_II0120    CDS       T02049                                 

Gene name
tssF-2
Definition
(GenBank) type VI secretion system
  KO
K11896  type VI secretion system protein ImpG
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0120 (tssF-2)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BP1026B_II0120 (tssF-2)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFI68403
UniProt: A0A0H3HVV6
Position
2:complement(139311..141191)
AA seq 626 aa
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSART
QLKLEAEFPRFTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSI
PPGEQTACEFRTGQDITLWPIEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVG
EIRFSQITGLDRLSLYIGGDERIASHLFELIHASSVASVVRAPGAARGEGAVVAKNAVDF
EGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQLNAGLSRIDGKEAEIVLLLD
RLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTRPLDYEVFSVS
RVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPS
APREPYATGETAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSL
VGARTEPVVRRLPGHGLLVYGRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVF
TETELRSMQRGLVTRWKPRMGGRGAV
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggacccgcagtttctcgatcactacaaccgcgaattgacctacatgcgggagttgtcc
gcggaattcgcggcgcaacacccgaagatcgcgcgccgactcggcatgcaaggcatcgaa
gtggcggacccgtacgtagaacggctcatcgaggcgttctgcttcatgtccgcgcgcacg
caactcaagctcgaggccgagttcccccgcttcacgcaacgcctgctcgaagtcgcctat
ccgaattacgtcgcgccgacgccgtcgatggccgtcgcgcgcctgcgtccaagcctgcgg
gaaggcgacttcagcaaggggttcaaggttccgcgtcacagcatgctgcgctcgtcgatc
ccgcccggcgagcagaccgcatgcgaattccgcaccggccaggacatcacgctctggccc
atcgagatcgccggcgcgacgctgaccgccgtgccgcccgatcttccggatcttcagcgc
agcctgctgccgcacacgaagctgcgcggcgcactccggctgcgcgtgcgcaccgtcggc
gaaatcaggttttcgcaaattaccgggctcgatcgcctctcgctgtatatcggcggcgac
gaacgcatcgcctcccatcttttcgagctgattcacgcgagcagcgtcgcgtcggtcgtg
cgcgcgccgggcgccgcgcgcggcgaaggcgccgtcgtcgcgaagaatgcggtcgacttc
gaaggcctgtcgcccgatcaaagcctgttgccgctcgtctggaatacgttccacgggcac
aatctgctgcacgaatacttcacctgccgtcagcgcttctatttcttcgcgctcacgcaa
ttgaacgccggcttgtcgcgcatcgacggaaaggaagccgaaatcgtgctgttgctcgac
cgcttgcccgacgagctcgtcacgcacgtcgaggccgcgcgctttctgctgttttgcgcc
cccatcgtcaatctgttcccgaagcggaccgaccgggtggaaatcaatcgcgcccaaacg
gctttccacctgataccggaccgcacccgcccgctcgattacgaagtattctcggtgtcg
cgcgtgttcgggcaaaaagccgagacgtcgacggaagtcacgttcaatccgctctatcag
acgctgcatagcgacatcggcaattacggccggtatttctcgatcctgcgcgaacccaga
acgacatcgaccaacgcacgcaagtatggaacgcgcacgccatacgtcggaacggaagtc
tacgtgtcgctcgtcgaccaggccgaagcgccgtacgccgacgacattcgttacctgtcc
gtcgacgcatgggtcaccaaccgcgatctgccccgactgatcccgcgcaacggcgtcaac
gatctgacgatgcaagactccgtgccgatcgagggcgtgagcctcgtccatccgccgagc
gcgccgcgcgagccgtacgcgaccggcgaaaccgcgtggcggctgattcgccagctcagc
ttcaactacatgccgcttgccgagctcgaccaccgcgacggcgggcaagcactgcgcaac
atgctgcgcctcttcgtcggcacgagcgagcgcgaacaggccacgcagatcgacagcctg
gtcggcgcgcgcacggagcctgtcgtccgccgtctgcccggccacggattactggtttac
gggcgcggcgtccggtgcgagctgaccgtcgacgaaagcggcttctccgggttgagtcca
tacctgttcggtctcgtgctcgagcaatacctcacgcgccacgtctcgatcaatgtgttc
accgagacggagcttcgctcgatgcaacgcggtctcgtcacgcgctggaaaccgcgcatg
ggcggaaggggcgcggtatga

DBGET integrated database retrieval system