KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0122
Entry
BP1026B_II0122    CDS       T02049                                 

Gene name
tagJ-2
Definition
(GenBank) type VI secretion system
  KO
K11898  type VI secretion system protein ImpE
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpz02044]
    BP1026B_II0122 (tagJ-2)
Secretion system [BR:bpz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BP1026B_II0122 (tagJ-2)
SSDB
Motif
Pfam: ImpE
Other DBs
NCBI-ProteinID: AFI68405
UniProt: A0A0H3HU71
Position
2:complement(141698..142552)
AA seq 284 aa
MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGA
WERALKQLQTWAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQ
ANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYR
WIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSGSENGATAIRLASET
TWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
NT seq 855 nt   +upstreamnt  +downstreamnt
atgacgaatcgatctgaatctccgcaaccctccgatccgcgtgacgccatgctgcgcgac
gcgctgcgcgcccagtctttcgaggaaatcaaggcgcgcacggccgaggcggtcagaaag
cggccatccgacacgcgggaacgctggctactgtttcagttgctttgcatcgacggcgcg
tgggagcgcgcgctcaaacagctgcaaacctgggccgggctcgagccgcagggcgaggcg
cgcgcgcaactgcatcgcggcctgatccgatgcgaaatgttccgggccgacgtgtttgcc
ggcaagcgaacgccggggttcatcgacgcgcagcccgcctgggtcgacacgctcctccaa
gccaatgcgaagctcggcgccggcgacgtcgcggcggcggacacgctgcgcgaagccgcg
ttccactgcgcccctgtcacccgcggggaaagcgccgaaatgggaagcttcgcatggctt
accgacagcgacacccgcctcggtccgatctttgaaatagcggttgcaggcggctatcga
tggattccgttcgaacaactgaagtccatcacgtttacgcccgccggcacgctgaccgac
ctggtctggcgaccggtcacggcactcatgctcgatgccacggttctccgcggctatgca
cccacccgctattcgggatcggagaacggcgcgaccgcgatccgcttggccagcgagacg
acctggcgcgacatcggcaccaccaacgtcgtggcgctcggacaacgaacatggaccacc
gatcagggcgactggggcatgctccagatcggcggatgccgcttcacgggcgaaagcgac
gatgcggcatcctga

DBGET integrated database retrieval system